Mouse anti-Human OMP Monoclonal Antibody | anti-OMP antibody

OMP (Olfactory Marker Protein, Olfactory Neuronal-specific Protein) (FITC)

Cat. Num. AAA6148617

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: OMP; Monoclonal Antibody; OMP (Olfactory Marker Protein; Olfactory Neuronal-specific Protein) (FITC); anti-OMP antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2B7
• Specificity: Recognizes human OMP.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-OMP antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa65-164 from human OMP (NP_006180) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: FERWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKASVVFNQL
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(Western Blot analysis of OMP expression in transfected 293T cell line by OMP monoclonal antibody. Lane 1: OMP transfected lysate (Predicted MW: 18.9kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged OMP is 0.3ng/ml as a capture antibody.)

Related Product Information for anti-OMP antibody

Olfactory marker protein (OMP) is an abundant, 19kD, cytosolic protein that is almost exclusively expressed in mature, functioning, olfactory neurons but not in the neural precursor basal cells. The OMP gene structure and protein sequence are highly conserved between mouse, rat and human. Its tissue-specific expression in the receptor cells together with the results of the mouse knockout studies show that OMP represents a novel modulatory component of the odor detection/signal transduction cascade. May act as a modulator of the olfactory signal-transduction cascade.

Product Categories/Family for anti-OMP antibody

Antibodies; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 5453828
• NCBI GeneID: 4975
• NCBI Accession #: NP_006180
• NCBI GenBank Nucleotide #: NM_006189
• UniProt Accession #: P47874; Q562G2
• Molecular Weight: 21.3 kDa (186aa) confirmed by MALDI-TOF
• NCBI Official Full Name: olfactory marker protein
• NCBI Official Synonym Full Names: olfactory marker protein
• NCBI Official Symbol: OMP
• NCBI Protein Information: olfactory marker protein
• UniProt Protein Name: Olfactory marker protein
• Protein Family: OmpA-like protein
• UniProt Gene Name: OMP
• UniProt Entry Name: OMP_HUMAN

NCBI Description

Olfactory marker protein is uniquely associated with the mature olfactory receptor neurons in many vertebrate species from fish to man. The OMP gene structure and protein sequence are highly conserved between mouse, rat and human. Results of the mouse knockout studies show that OMP-null mice are compromised in their ability to respond to odor stimuli, and that OMP represents a novel modulatory component of the odor detection/signal transduction cascade. [provided by RefSeq, Jul 2008]

Uniprot Description

OMP: May act as a modulator of the olfactory signal- transduction cascade. Belongs to the olfactory marker protein family.

Chromosomal Location of Human Ortholog: 11q13.5

Cellular Component: cell soma; axon; cytoplasm; nucleus

Molecular Function: signal transducer activity

Biological Process: synaptic transmission; neurogenesis; sensory perception of smell; signal transduction