Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human OMP Monoclonal Antibody | anti-OMP antibody

OMP (Olfactory Marker Protein, Olfactory Neuronal-specific Protein) APC

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
OMP; Monoclonal Antibody; OMP (Olfactory Marker Protein; Olfactory Neuronal-specific Protein) APC; anti-OMP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B7
Specificity
Recognizes human OMP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-OMP antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa65-164 from human OMP (NP_006180) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FERWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKASVVFNQL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(Western Blot analysis of OMP expression in transfected 293T cell line by OMP monoclonal antibody. Lane 1: OMP transfected lysate (Predicted MW: 18.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of OMP expression in transfected 293T cell line by OMP monoclonal antibody. Lane 1: OMP transfected lysate (Predicted MW: 18.9kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged OMP is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged OMP is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-OMP antibody
Olfactory marker protein (OMP) is an abundant, 19kD, cytosolic protein that is almost exclusively expressed in mature, functioning, olfactory neurons but not in the neural precursor basal cells. The OMP gene structure and protein sequence are highly conserved between mouse, rat and human. Its tissue-specific expression in the receptor cells together with the results of the mouse knockout studies show that OMP represents a novel modulatory component of the odor detection/signal transduction cascade. May act as a modulator of the olfactory signal-transduction cascade.
Product Categories/Family for anti-OMP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21.3 kDa (186aa) confirmed by MALDI-TOF
NCBI Official Full Name
olfactory marker protein
NCBI Official Synonym Full Names
olfactory marker protein
NCBI Official Symbol
OMP
NCBI Protein Information
olfactory marker protein
UniProt Protein Name
Olfactory marker protein
Protein Family
UniProt Gene Name
OMP
UniProt Entry Name
OMP_HUMAN

NCBI Description

Olfactory marker protein is uniquely associated with the mature olfactory receptor neurons in many vertebrate species from fish to man. The OMP gene structure and protein sequence are highly conserved between mouse, rat and human. Results of the mouse knockout studies show that OMP-null mice are compromised in their ability to respond to odor stimuli, and that OMP represents a novel modulatory component of the odor detection/signal transduction cascade. [provided by RefSeq, Jul 2008]

Uniprot Description

OMP: May act as a modulator of the olfactory signal- transduction cascade. Belongs to the olfactory marker protein family.

Chromosomal Location of Human Ortholog: 11q13.5

Cellular Component: cell soma; axon; cytoplasm; nucleus

Molecular Function: signal transducer activity

Biological Process: synaptic transmission; neurogenesis; sensory perception of smell; signal transduction

Research Articles on OMP

Similar Products

Product Notes

The OMP omp (Catalog #AAA6138011) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The OMP (Olfactory Marker Protein, Olfactory Neuronal-specific Protein) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's OMP can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the OMP omp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "OMP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.