Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse OLIG2 Monoclonal Antibody | anti-OLIG2 antibody

OLIG2 (Oligodendrocyte Lineage Transcription Factor 2, BHLHB1, OLIGO2, PRKCBP2, RACK17, bHLHe19) (MaxLight 550)

Gene Names
OLIG2; BHLHB1; OLIGO2; RACK17; PRKCBP2; bHLHe19
Applications
Immunofluorescence, Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
OLIG2; Monoclonal Antibody; OLIG2 (Oligodendrocyte Lineage Transcription Factor 2; BHLHB1; OLIGO2; PRKCBP2; RACK17; bHLHe19) (MaxLight 550); Oligodendrocyte Lineage Transcription Factor 2; bHLHe19; anti-OLIG2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D7
Specificity
Recognizes OLIG2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-OLIG2 antibody
FLISA, Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
OLIG2 (NP_005797, 2aa-78aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKSS
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-OLIG2 antibody
This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome. [provided by RefSeq]
Product Categories/Family for anti-OLIG2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 36 kDa

Observed: 37 kDa
NCBI Official Full Name
oligodendrocyte transcription factor 2
NCBI Official Synonym Full Names
oligodendrocyte lineage transcription factor 2
NCBI Official Symbol
OLIG2
NCBI Official Synonym Symbols
BHLHB1; OLIGO2; RACK17; PRKCBP2; bHLHe19
NCBI Protein Information
oligodendrocyte transcription factor 2; protein kinase C-binding protein 2; class B basic helix-loop-helix protein 1; class E basic helix-loop-helix protein 19; human protein kinase C-binding protein RACK17; basic domain, helix-loop-helix protein, class B
UniProt Protein Name
Oligodendrocyte transcription factor 2
UniProt Gene Name
OLIG2
UniProt Synonym Gene Names
BHLHB1; BHLHE19; PRKCBP2; RACK17; Oligo2; bHLHb1; bHLHe19
UniProt Entry Name
OLIG2_HUMAN

NCBI Description

This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome. [provided by RefSeq, Jul 2008]

Uniprot Description

OLIG2: Required for oligodendrocyte and motor neuron specification in the spinal cord, as well as for the development of somatic motor neurons in the hindbrain. Cooperates with OLIG1 to establish the pMN domain of the embryonic neural tube. Antagonist of V2 interneuron and of NKX2-2-induced V3 interneuron development. A chromosomal aberration involving OLIG2 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(14;21)(q11.2;q22) with TCRA.

Protein type: Transcription factor; Oncoprotein

Chromosomal Location of Human Ortholog: 21q22.11

Cellular Component: cytoplasm; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein homodimerization activity; DNA binding

Biological Process: transcription from RNA polymerase II promoter; myelination; negative regulation of neuron differentiation; spinal cord oligodendrocyte cell fate specification; neuron fate commitment; thalamus development; negative regulation of transcription from RNA polymerase II promoter; positive regulation of oligodendrocyte differentiation; spinal cord motor neuron differentiation

Research Articles on OLIG2

Similar Products

Product Notes

The OLIG2 olig2 (Catalog #AAA6218389) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's OLIG2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the OLIG2 olig2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "OLIG2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.