Mouse OLFM3 Monoclonal Antibody | anti-OLFM3 antibody

OLFM3 (Olfactomedin 3, Noelin-3, Olfactomedin-3, Optimedin, NOE3, UNQ1924/PRO4399) (FITC)

Cat. Num. AAA6148612

• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: OLFM3; Monoclonal Antibody; OLFM3 (Olfactomedin 3; Noelin-3; Olfactomedin-3; Optimedin; NOE3; UNQ1924/PRO4399) (FITC); anti-OLFM3 antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3A2
• Specificity: Recognizes human OLFM3. Species Crossreactivity: mouse and rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 458

• Applicable Applications for anti-OLFM3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa108-207 from human OLFM3 (NP_477518) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: FRQIEDDRKTLMTKHFQELKEKMDELLPLIPVLEQYKTDAKLITQFKEEIRNLSAVLTGIQEEIGAYDYEELHQRVLSLETRLRDCMKKLTCGKLMKIT
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(OLFM3 monoclonal antibody. Western Blot analysis of OLFM3 expression in PC-12.)

Western Blot (WB)

(OLFM3 monoclonal antibody. Western Blot analysis of OLFM3 expression in Raw 264.7.)

Western Blot (WB)

(OLFM3 monoclonal antibody, Western Blot analysis of OLFM3 expression in NIH/3T3.)

Testing Data

(Detection limit for recombinant GST tagged OLFM3 is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-OLFM3 antibody

Peripherally associated with AMPAR complex. AMPAR complex consists of an inner core made of 4 pore-forming GluA/GRIA proteins (GRIA1, GRIA2, GRIA3 and GRIA4) and 4 major auxiliary subunits arranged in a twofold symmetry. One of the two pairs of distinct binding sites is occupied either by CNIH2, CNIH3 or CACNG2, CACNG3. The other harbors CACNG2, CACNG3, CACNG4, CACNG8 or GSG1L. This inner core of AMPAR complex is complemented by outer core constituents binding directly to the GluA/GRIA proteins at sites distinct from the interaction sites of the inner core constituents. Outer core constituents include at least PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L and NRN1. The proteins of the inner and outer core serve as a platform for other, more peripherally associated AMPAR constituents, including OLFM3. Alone or in combination, these auxiliary subunits control the gating and pharmacology of the AMPAR complex and profoundly impact their biogenesis and protein processing. Homodimer. Interacts with MYOC.

Product Categories/Family for anti-OLFM3 antibody

Antibodies; Extracellular Matrix Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 166706897
• NCBI Accession #: NP_477518
• NCBI GenBank Nucleotide #: NM_058170
• UniProt Accession #: Q96PB7
• NCBI Official Full Name: noelin-3 isoform 2
• UniProt Protein Name: Noelin-3
• Protein Family: Noelin
• UniProt Gene Name: OLFM3
• UniProt Synonym Gene Names: NOE3
• UniProt Entry Name: NOE3_HUMAN