Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to OAS1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Mouse anti-Human OAS1 Monoclonal Antibody | anti-OAS1 antibody

OAS1 (2', 5'-Oligoadenylate Synthetase 1, (2-5')oligo(A) Synthase 1, 2-5A Synthase 1, E18/E16, p46/p42 OAS, OIAS) APC

Gene Names
OAS1; OIAS; IFI-4; OIASI; E18/E16
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Immunoprecipitation
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
OAS1; Monoclonal Antibody; OAS1 (2'; 5'-Oligoadenylate Synthetase 1; (2-5')oligo(A) Synthase 1; 2-5A Synthase 1; E18/E16; p46/p42 OAS; OIAS) APC; anti-OAS1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D4
Specificity
Recognizes human OAS1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
1376
Applicable Applications for anti-OAS1 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from human OAS1 (AAH00562) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SVSRRDKSKQVWEAVLLPLSLLSMMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDAD
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to OAS1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to OAS1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to OAS1 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to OAS1 on HeLa cell. [antibody concentration 10ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of OAS1 transfected lysate using OAS1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with OAS1 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of OAS1 transfected lysate using OAS1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with OAS1 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged OAS1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged OAS1 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-OAS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens 2',5'-oligoadenylate synthetase 1, 40/46kDa, mRNA
NCBI Official Synonym Full Names
2'-5'-oligoadenylate synthetase 1
NCBI Official Symbol
OAS1
NCBI Official Synonym Symbols
OIAS; IFI-4; OIASI; E18/E16
NCBI Protein Information
2'-5'-oligoadenylate synthase 1

NCBI Description

This gene is induced by interferons and encodes a protein that synthesizes 2',5'-oligoadenylates (2-5As). This protein activates latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. Alternative splicing results in multiple transcript variants with different enzymatic activities. Polymorphisms in this gene have been associated with susceptibility to viral infection and diabetes mellitus, type 1. A disease-associated allele in a splice acceptor site influences the production of the p46 splice isoform. This gene is located in a cluster of related genes on chromosome 12. [provided by RefSeq, Feb 2016]

Research Articles on OAS1

Similar Products

Product Notes

The OAS1 (Catalog #AAA6137996) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The OAS1 (2', 5'-Oligoadenylate Synthetase 1, (2-5')oligo(A) Synthase 1, 2-5A Synthase 1, E18/E16, p46/p42 OAS, OIAS) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's OAS1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the OAS1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "OAS1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.