Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human NUP50 Monoclonal Antibody | anti-NUP50 antibody

NUP50 (NUP50, NPAP60L, Nuclear Pore Complex Protein Nup50, 50kD Nucleoporin, Nuclear Pore-associated Protein 60kD-like, Nucleoporin Nup50, MGC39961) (MaxLight 490)

Gene Names
NUP50; NPAP60; NPAP60L
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NUP50; Monoclonal Antibody; NUP50 (NUP50; NPAP60L; Nuclear Pore Complex Protein Nup50; 50kD Nucleoporin; Nuclear Pore-associated Protein 60kD-like; Nucleoporin Nup50; MGC39961) (MaxLight 490); anti-NUP50 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4H7
Specificity
Recognizes human NUP50.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Sequence Length
440
Applicable Applications for anti-NUP50 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa342-439 from human NUP50 (NP_705931) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DNEFKEKGIGTLHLKPTANQKTQLLVRADTNLGNILLNVLIPPNMPCTRTGKNNVLIVCVPNPPIDEKNATMPVTMLIRVKTSEDADELHKILLEKKD
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-NUP50 antibody
MaxLight490 is a new Blue-Green photostable dye conjugate comparable to DyLight488, Alexa Fluor488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000.
Product Categories/Family for anti-NUP50 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
nuclear pore complex protein Nup50 isoform a
NCBI Official Synonym Full Names
nucleoporin 50
NCBI Official Symbol
NUP50
NCBI Official Synonym Symbols
NPAP60; NPAP60L
NCBI Protein Information
nuclear pore complex protein Nup50
UniProt Protein Name
Nuclear pore complex protein Nup50
UniProt Gene Name
NUP50
UniProt Synonym Gene Names
NPAP60L
UniProt Entry Name
NUP50_HUMAN

NCBI Description

The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import. Pseudogenes of this gene are found on chromosomes 5, 6, and 14. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

NUP50: Component of the nuclear pore complex that has a direct role in nuclear protein import. Actively displaces NLSs from importin-alpha, and facilitates disassembly of the importin- alpha:beta-cargo complex and importin recycling. Interacts with multiple transport receptor proteins including CDKN1B. This interaction is required for correct intracellular transport and degradation of CDKN1B. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleoporin; Nuclear import

Chromosomal Location of Human Ortholog: 22q13.31

Cellular Component: nucleoplasm; nuclear membrane; cytoplasm; nuclear pore

Molecular Function: protein binding

Biological Process: mRNA transport; viral reproduction; cytokine and chemokine mediated signaling pathway; mitotic nuclear envelope disassembly; pathogenesis; glucose transport; viral infectious cycle; protein transport; intracellular transport; hexose transport; carbohydrate metabolic process; gene expression; viral transcription; mitotic cell cycle; transmembrane transport

Research Articles on NUP50

Similar Products

Product Notes

The NUP50 nup50 (Catalog #AAA6202225) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NUP50 (NUP50, NPAP60L, Nuclear Pore Complex Protein Nup50, 50kD Nucleoporin, Nuclear Pore-associated Protein 60kD-like, Nucleoporin Nup50, MGC39961) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NUP50 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NUP50 nup50 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NUP50, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.