Mouse anti-Human NUDT2 Monoclonal Antibody | anti-NUDT2 antibody

NUDT2 (Nudix-type Motif 2, APAH1, Bis(5'-nucleosyl)-tetraphosphatase [Asymmetrical], Diadenosine 5',5'''-P1,P4-tetraphosphate Asymmetrical Hydrolase, Diadenosine Tetraphosphatase, Ap4A Hydrolase, Ap4Aase, Nucleoside Diphosphate-linked Moiety X Motif 2) (P

Cat. Num. AAA6159192

• Gene Names: NUDT2; APAH1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NUDT2; Monoclonal Antibody; NUDT2 (Nudix-type Motif 2; APAH1; Bis(5'-nucleosyl)-tetraphosphatase [Asymmetrical]; Diadenosine 5'; 5'''-P1; P4-tetraphosphate Asymmetrical Hydrolase; Diadenosine Tetraphosphatase; Ap4A Hydrolase; Ap4Aase; Nucleoside Diphosphate-linked Moiety X Motif 2) (P; anti-NUDT2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4A4-3C3
• Specificity: Recognizes human NUDT2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-NUDT2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-147 from human NUDT2 (AAH04926) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (41.91kD).)

Western Blot (WB)

(NUDT2 monoclonal antibody, Western Blot analysis of NUDT2 expression in Jurkat.)

Western Blot (WB)

(Western Blot analysis of NUDT2 expression in transfected 293T cell line by NUDT2 monoclonal antibody. Lane 1: NUDT2 transfected lysate (16.8kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged NUDT2 is ~0.3ng/ml as a capture antibody.)

Related Product Information for anti-NUDT2 antibody

This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. Alternative splicing has been observed at this locus and three transcript variants, all encoding the same protein, have been identified.

Product Categories/Family for anti-NUDT2 antibody

Antibodies; RNA Processing

References

1. Nudix-type motif 2 (NUDT2) in human breast carcinoma: A potent prognostic factor associated with cell proliferation. Oka K, Suzuki T, Onodera Y, Miki Y, Takagi K, Nagasaki S, Akahira JI, Ishida T, Watanabe M, Hirakawa H, Ohuchi N, Sasano H.Int J Cancer. 2010 Jun 9.

NCBI and Uniprot Product Information

• NCBI GI #: 34189644
• NCBI GeneID: 318
• NCBI Official Full Name: Homo sapiens nudix (nucleoside diphosphate linked moiety X)-type motif 2, mRNA
• NCBI Official Synonym Full Names: nudix hydrolase 2
• NCBI Official Symbol: NUDT2
• NCBI Official Synonym Symbols: APAH1
• NCBI Protein Information: bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
• Protein Family: Nudix hydrolase

NCBI Description

This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. Alternative splicing has been observed at this locus and four transcript variants, all encoding the same protein, have been identified. [provided by RefSeq, Sep 2011]