Mouse anti-Human NUDC Monoclonal Antibody | anti-NUDC antibody

NUDC (Nuclear Migration Protein nudC, Nuclear Distribution Protein C Homolog) (HRP)

Cat. Num. AAA6153884

• Gene Names: NUDC; HNUDC; MNUDC; NPD011
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NUDC; Monoclonal Antibody; NUDC (Nuclear Migration Protein nudC; Nuclear Distribution Protein C Homolog) (HRP); anti-NUDC antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5G12
• Specificity: Recognizes human NUDC.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 1308

• Applicable Applications for anti-NUDC antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-331 from human NUDC (AAH02399) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTRREKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEGEDEKDKGKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (62.52kD).)

Western Blot (WB)

(NUDC monoclonal antibody Western Blot analysis of NUDC expression in HeLa.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to NUDC on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged NUDC is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-NUDC antibody

NudC was first identified as a regulator of nuclear movement in the asexual reproductive cycle of the filamentous fungus Aspergillus nidulans. Human NUDC is a nuclear movement protein that associates with dynein (see DYNC1H1; MIM 600112) (Aumais et al., 2003 [PubMed 12679384]).

Product Categories/Family for anti-NUDC antibody

Antibodies; Nuclear Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 38197208
• NCBI GeneID: 10726
• NCBI Official Full Name: Homo sapiens nuclear distribution gene C homolog (A. nidulans), mRNA
• NCBI Official Synonym Full Names: nuclear distribution C, dynein complex regulator
• NCBI Official Symbol: NUDC
• NCBI Official Synonym Symbols: HNUDC; MNUDC; NPD011
• NCBI Protein Information: nuclear migration protein nudC
• Protein Family: NADH pyrophosphatase

NCBI Description

This gene encodes a nuclear distribution protein that plays an essential role in mitosis and cytokinesis. The encoded protein is involved in spindle formation during mitosis and in microtubule organization during cytokinesis. Pseudogenes of this gene are found on chromosome 2. [provided by RefSeq, Feb 2012]