Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Mouse anti-Human NUAK2 Monoclonal Antibody | anti-NUAK2 antibody

NUAK2 (NUAK Family SNF1-like Kinase 2, Omphalocele Kinase 2, SNF1/AMP Kinase-related Kinase, SNARK, OMPHK2, DKFZp434J037, DKFZp686F01113, FLJ90349) (Biotin)

Gene Names
NUAK2; SNARK
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NUAK2; Monoclonal Antibody; NUAK2 (NUAK Family SNF1-like Kinase 2; Omphalocele Kinase 2; SNF1/AMP Kinase-related Kinase; SNARK; OMPHK2; DKFZp434J037; DKFZp686F01113; FLJ90349) (Biotin); anti-NUAK2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F9
Specificity
Recognizes human NUAK2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-NUAK2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa521-629 from human NUAK2 (NP_112214) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FGSLDELAPPRPLARASRPSGAVSEDSILSSESFDQLDLPERLPEPPLRGCVSVDNLTGLEEPPSEGPGSCLRRWRQDPLGDSCFSLTDCQEVTATYRQALRVCSKLT
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)
Related Product Information for anti-NUAK2 antibody
Stress-activated kinase involved in tolerance to glucose starvation. Induces cell-cell detachment by increasing F-actin conversion to G-actin. Expression is induced by CD95 or TNF-alpha, via NF-kappa-B. Protects cells from CD95-mediated apoptosis and is required for the increased motility and invasiveness of CD95-activated tumor cells.
Product Categories/Family for anti-NUAK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69,612 Da
NCBI Official Full Name
NUAK family SNF1-like kinase 2
NCBI Official Synonym Full Names
NUAK family, SNF1-like kinase, 2
NCBI Official Symbol
NUAK2
NCBI Official Synonym Symbols
SNARK
NCBI Protein Information
NUAK family SNF1-like kinase 2; omphalocele kinase 2; SNF1/AMP kinase-related kinase; SNF1/AMP activated protein kinase
UniProt Protein Name
NUAK family SNF1-like kinase 2
UniProt Gene Name
NUAK2
UniProt Synonym Gene Names
SNARK
UniProt Entry Name
NUAK2_HUMAN

Uniprot Description

NuaK2: a Ca(2+)/calmodulin-dependent protein kinase of the CAMKL family.

Protein type: Protein kinase, Ser/Thr (non-receptor); Kinase, protein; Protein kinase, CAMK; EC 2.7.11.1; CAMK group; CAMKL family; NuaK subfamily

Chromosomal Location of Human Ortholog: 1q32.1

Molecular Function: protein serine/threonine kinase activity; protein binding; magnesium ion binding; ATP binding

Biological Process: cellular response to glucose starvation; apoptosis; actin cytoskeleton organization and biogenesis; protein amino acid phosphorylation; negative regulation of apoptosis

Research Articles on NUAK2

Similar Products

Product Notes

The NUAK2 nuak2 (Catalog #AAA6143275) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NUAK2 (NUAK Family SNF1-like Kinase 2, Omphalocele Kinase 2, SNF1/AMP Kinase-related Kinase, SNARK, OMPHK2, DKFZp434J037, DKFZp686F01113, FLJ90349) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NUAK2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NUAK2 nuak2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NUAK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.