Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human NSD1 Monoclonal Antibody | anti-NSD1 antibody

NSD1 (NSD-1, Nuclear Receptor Binding SET Domain Protein 1, ARA267, ARA-267, Androgen Receptor-associated Coregulator 267kD, Histone-lysine N-methyltransferase, H3 Lysine-36 and H4 Lysine-20 Specific, H3-K36-HMTase, H4-K20-HMTase, Androgen Receptor-Associ

Gene Names
NSD1; STO; KMT3B; SOTOS; ARA267; FLJ10684; FLJ22263; FLJ44628; DKFZp666C163
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NSD1; Monoclonal Antibody; NSD1 (NSD-1; Nuclear Receptor Binding SET Domain Protein 1; ARA267; ARA-267; Androgen Receptor-associated Coregulator 267kD; Histone-lysine N-methyltransferase; H3 Lysine-36 and H4 Lysine-20 Specific; H3-K36-HMTase; H4-K20-HMTase; Androgen Receptor-Associ; anti-NSD1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F1
Specificity
Recognizes human NSD1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-NSD1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa2-110 from human NSD1 (NP_071900) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLSTVSGTSQNAYGQDSPSCYIPLRRLQDLASMINVEYLNGSADGSESFQDPEKSDSRAQT
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-NSD1 antibody
This gene encodes a protein containing a SET domain, 2 LXXLL motifs, 3 nuclear translocation signals (NLSs), 4 plant homeodomain (PHD) finger regions, and a proline-rich region. The encoded protein enhances androgen receptor (AR) transactivation, and this enhancement can be increased further in the presence of other androgen receptor associated coregulators. This protein may act as a nucleus-localized, basic transcriptional factor and also as a bifunctional transcriptional regulator. Mutations of this gene have been associated with Sotos syndrome and Weaver syndrome. One version of childhood acute myeloid leukemia is the result of a cryptic translocation with the breakpoints occurring within nuclear receptor-binding Su-var, enhancer of zeste, and trithorax domain protein 1 on chromosome 5 and nucleoporin, 98-kd on chromosome 11. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]
Product Categories/Family for anti-NSD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
296,652 Da
NCBI Official Full Name
histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific isoform b
NCBI Official Synonym Full Names
nuclear receptor binding SET domain protein 1
NCBI Official Symbol
NSD1
NCBI Official Synonym Symbols
STO; KMT3B; SOTOS; ARA267; FLJ10684; FLJ22263; FLJ44628; DKFZp666C163
NCBI Protein Information
histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific; H3-K36-HMTase; H4-K20-HMTase; OTTHUMP00000161431; OTTHUMP00000161432; lysine N-methyltransferase 3B; NR-binding SET domain-containing protein; androgen receptor-associated coregul
UniProt Protein Name
Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific
UniProt Gene Name
NSD1
UniProt Synonym Gene Names
ARA267; KMT3B
UniProt Entry Name
NSD1_HUMAN

Similar Products

Product Notes

The NSD1 nsd1 (Catalog #AAA6191524) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NSD1 (NSD-1, Nuclear Receptor Binding SET Domain Protein 1, ARA267, ARA-267, Androgen Receptor-associated Coregulator 267kD, Histone-lysine N-methyltransferase, H3 Lysine-36 and H4 Lysine-20 Specific, H3-K36-HMTase, H4-K20-HMTase, Androgen Receptor-Associ reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NSD1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NSD1 nsd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NSD1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.