Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.56kD).)

Mouse anti-Human NRP2 Monoclonal Antibody | anti-NRP2 antibody

NRP2 (Neuropilin-2, VEGF165R2, Vascular Endothelial Cell Growth Factor 165 Receptor 2, MGC126574, NP2, NPN2, PRO2714) (Biotin)

Gene Names
NRP2; NP2; NPN2; PRO2714; VEGF165R2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NRP2; Monoclonal Antibody; NRP2 (Neuropilin-2; VEGF165R2; Vascular Endothelial Cell Growth Factor 165 Receptor 2; MGC126574; NP2; NPN2; PRO2714) (Biotin); anti-NRP2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B8
Specificity
Recognizes human NRP2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
909
Applicable Applications for anti-NRP2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa621-715 from human NRP2 with GST tag (NP_958436). MW of the GST tag alone is 26kD.
Immunogen Sequence
EEATECGENCSFEDDKDLQLPSGFNCNFDFLEEPCGWMYDHAKWLRTTWASSSSPNDRTFPDDRNFLRLQSDSQREGQYARLISPPVHLPRSPVC
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.56kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.56kD).)

Testing Data

(Detection limit for 130576 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for 130576 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-NRP2 antibody
Neuropilin-2 (NRP2) is a member of the neuropilin family of receptor proteins. NRP2 is a transmembrane protein that binds to SEMA3C protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3C} and SEMA3F protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3F}, and interacts with vascular endothelial growth factor (VEGF). This protein may play a role in cardiovascular development, axon guidance, and tumorigenesis. Multiple transcript variants encoding distinct isoforms have been identified for this gene.
Product Categories/Family for anti-NRP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
neuropilin-2 isoform 3
NCBI Official Synonym Full Names
neuropilin 2
NCBI Official Symbol
NRP2
NCBI Official Synonym Symbols
NP2; NPN2; PRO2714; VEGF165R2
NCBI Protein Information
neuropilin-2
UniProt Protein Name
Neuropilin-2
Protein Family
UniProt Gene Name
NRP2
UniProt Synonym Gene Names
VEGF165R2
UniProt Entry Name
NRP2_HUMAN

NCBI Description

This gene encodes a member of the neuropilin family of receptor proteins. The encoded transmembrane protein binds to SEMA3C protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3C} and SEMA3F protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3F}, and interacts with vascular endothelial growth factor (VEGF). This protein may play a role in cardiovascular development, axon guidance, and tumorigenesis. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

NRP2: High affinity receptor for semaphorins 3C, 3F, VEGF-165 and VEGF-145 isoforms of VEGF, and the PLGF-2 isoform of PGF. Heterodimer with NRP1. Binds PLXNB1. Belongs to the neuropilin family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Motility/polarity/chemotaxis; Receptor, misc.

Chromosomal Location of Human Ortholog: 2q33.3

Cellular Component: membrane; extracellular region; plasma membrane; integral to membrane

Molecular Function: heparin binding; vascular endothelial growth factor receptor activity; semaphorin receptor activity; cytokine binding; growth factor binding; metal ion binding; receptor activity

Biological Process: axon extension involved in axon guidance; axon guidance; positive regulation of endothelial cell proliferation; nerve development; angiogenesis; vascular endothelial growth factor receptor signaling pathway; cell adhesion

Research Articles on NRP2

Similar Products

Product Notes

The NRP2 nrp2 (Catalog #AAA6143265) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NRP2 (Neuropilin-2, VEGF165R2, Vascular Endothelial Cell Growth Factor 165 Receptor 2, MGC126574, NP2, NPN2, PRO2714) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NRP2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NRP2 nrp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NRP2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.