Mouse anti-Human NR4A3 Monoclonal Antibody | anti-NR4A3 antibody

NR4A3 (Nuclear Receptor Subfamily 4 Group A Member 3, Mitogen-induced Nuclear Orphan Receptor, Neuron-derived Orphan Receptor 1, Nuclear Hormone Receptor NOR-1, CHN, CSMF, MINOR, NOR1, TEC) (Biotin)

Cat. Num. AAA6143259

• Gene Names: NR4A3; CHN; TEC; CSMF; NOR1; MINOR
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NR4A3; Monoclonal Antibody; NR4A3 (Nuclear Receptor Subfamily 4 Group A Member 3; Mitogen-induced Nuclear Orphan Receptor; Neuron-derived Orphan Receptor 1; Nuclear Hormone Receptor NOR-1; CHN; CSMF; MINOR; NOR1; TEC) (Biotin); anti-NR4A3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1E9
• Specificity: Recognizes human NR4A3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 626

• Applicable Applications for anti-NR4A3 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa414-522 from NR4A3 (NP_008912) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFS*
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.99kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to NR4A3 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged NR4A3 is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-NR4A3 antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 27894355
• NCBI GeneID: 8013
• NCBI Accession #: NP_008912
• NCBI GenBank Nucleotide #: NM_006981
• UniProt Accession #: Q92570
• NCBI Official Full Name: nuclear receptor subfamily 4 group A member 3 isoform a
• NCBI Official Synonym Full Names: nuclear receptor subfamily 4 group A member 3
• NCBI Official Symbol: NR4A3
• NCBI Official Synonym Symbols: CHN; TEC; CSMF; NOR1; MINOR
• NCBI Protein Information: nuclear receptor subfamily 4 group A member 3
• UniProt Protein Name: Nuclear receptor subfamily 4 group A member 3
• Protein Family: Nuclear receptor subfamily
• UniProt Gene Name: NR4A3
• UniProt Synonym Gene Names: CHN; CSMF; MINOR; NOR1; TEC
• UniProt Entry Name: NR4A3_HUMAN

NCBI Description

This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcriptional activator. The protein can efficiently bind the NGFI-B Response Element (NBRE). Three different versions of extraskeletal myxoid chondrosarcomas (EMCs) are the result of reciprocal translocations between this gene and other genes. The translocation breakpoints are associated with Nuclear Receptor Subfamily 4, Group A, Member 3 (on chromosome 9) and either Ewing Sarcome Breakpoint Region 1 (on chromosome 22), RNA Polymerase II, TATA Box-Binding Protein-Associated Factor, 68-KD (on chromosome 17), or Transcription factor 12 (on chromosome 15). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010]

Uniprot Description

NR4A3: Binds to the B1A response-element. Defects in NR4A3 are a cause of Ewing sarcoma (ES). A highly malignant, metastatic, primitive small round cell tumor of bone and soft tissue that affects children and adolescents. It belongs to the Ewing sarcoma family of tumors, a group of morphologically heterogeneous neoplasms that share the same cytogenetic features. They are considered neural tumors derived from cells of the neural crest. Ewing sarcoma represents the less differentiated form of the tumors. A chromosomal aberration involving NR4A3 is found in patients with Erwing sarcoma. Translocation t(9;22)(q22-31;q11-12) with EWSR1. A chromosomal aberration involving NR4A3 is a cause of a form of extraskeletal myxoid chondrosarcomas (EMC). Translocation t(9;17)(q22;q11) with TAF2N. Belongs to the nuclear hormone receptor family. NR4 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Oncoprotein; DNA-binding; Nuclear receptor

Chromosomal Location of Human Ortholog: 9q22

Cellular Component: nucleoplasm; transcription factor complex; nucleus

Molecular Function: protein binding; DNA binding; zinc ion binding; sequence-specific DNA binding; steroid hormone receptor activity; thyroid hormone receptor activity

Biological Process: response to peptide hormone stimulus; axon guidance; transcription initiation from RNA polymerase II promoter; organ regeneration; intracellular receptor-mediated signaling pathway; hippocampus development; semicircular canal morphogenesis; positive regulation of cell cycle; response to hydrogen peroxide; mesoderm formation; vestibular reflex; adult behavior; positive regulation of transcription from RNA polymerase II promoter; steroid hormone mediated signaling; gene expression; negative regulation of neuron apoptosis; neuromuscular process controlling balance

Disease: Chondrosarcoma, Extraskeletal Myxoid