Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against immunogen using 130558 (36.63kD).)

Mouse anti-Human NR4A2 Monoclonal Antibody | anti-NR4A2 antibody

NR4A2 (Nuclear Receptor Subfamily 4 Group A Member 2, Immediate-early Response Protein NOT, Orphan Nuclear Receptor NURR1, Transcriptionally-inducible Nuclear Receptor, NOT, NURR1, TINUR) (FITC)

Gene Names
NR4A2; NOT; RNR1; HZF-3; NURR1; TINUR
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NR4A2; Monoclonal Antibody; NR4A2 (Nuclear Receptor Subfamily 4 Group A Member 2; Immediate-early Response Protein NOT; Orphan Nuclear Receptor NURR1; Transcriptionally-inducible Nuclear Receptor; NOT; NURR1; TINUR) (FITC); anti-NR4A2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4A6
Specificity
Recognizes human NR4A2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
2129
Applicable Applications for anti-NR4A2 antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa71-170 from human NR4A2 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFP
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against immunogen using 130558 (36.63kD).)

Western Blot (WB) (Western Blot detection against immunogen using 130558 (36.63kD).)

Western Blot (WB)

(Western Blot analysis of NR4A2 expression in transfected 293T cell line using 130558. Lane 1: NR4A2 transfected lysate (Predicted MW: 66.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NR4A2 expression in transfected 293T cell line using 130558. Lane 1: NR4A2 transfected lysate (Predicted MW: 66.6kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged NR4A2 is ~3ng/ml using 130558 as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NR4A2 is ~3ng/ml using 130558 as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of HeLa cells using 130558 (10ug/ml).)

Immunofluorescence (IF) (Immunofluorescence of HeLa cells using 130558 (10ug/ml).)
Related Product Information for anti-NR4A2 antibody
This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcription factor. Mutations in this gene have been associated with disorders related to dopaminergic dysfunction, including Parkinson disease, schizophernia, and manic depression. Misregulation of this gene may be associated with rheumatoid arthritis. Four transcript variants encoding four distinct isoforms have been identified for this gene. Additional alternate splice variants may exist, but their full length nature has not been determined.
Product Categories/Family for anti-NR4A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens nuclear receptor subfamily 4, group A, member 2, mRNA
NCBI Official Synonym Full Names
nuclear receptor subfamily 4 group A member 2
NCBI Official Symbol
NR4A2
NCBI Official Synonym Symbols
NOT; RNR1; HZF-3; NURR1; TINUR
NCBI Protein Information
nuclear receptor subfamily 4 group A member 2

NCBI Description

This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcription factor. Mutations in this gene have been associated with disorders related to dopaminergic dysfunction, including Parkinson disease, schizophernia, and manic depression. Misregulation of this gene may be associated with rheumatoid arthritis. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]

Research Articles on NR4A2

Similar Products

Product Notes

The NR4A2 (Catalog #AAA6148561) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NR4A2 (Nuclear Receptor Subfamily 4 Group A Member 2, Immediate-early Response Protein NOT, Orphan Nuclear Receptor NURR1, Transcriptionally-inducible Nuclear Receptor, NOT, NURR1, TINUR) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NR4A2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NR4A2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NR4A2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.