Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged NR2F2 is approximately 10ng/ml as a capture antibody.)

Mouse NR2F2 Monoclonal Antibody | anti-NR2F2 antibody

NR2F2 (Nuclear Receptor Subfamily 2, Group F, Member 2, ARP1, COUP-TFII, COUPTFB, MGC117452, SVP40, TFCOUP2) (HRP)

Gene Names
NR2F2; ARP1; CHTD4; NF-E3; NR2F1; SVP40; COUPTFB; TFCOUP2; COUPTFII
Applications
ELISA
Purity
Purified
Synonyms
NR2F2; Monoclonal Antibody; NR2F2 (Nuclear Receptor Subfamily 2; Group F; Member 2; ARP1; COUP-TFII; COUPTFB; MGC117452; SVP40; TFCOUP2) (HRP); Nuclear Receptor Subfamily 2; TFCOUP2; anti-NR2F2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B5
Specificity
Recognizes NR2F2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-NR2F2 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NR2F2 (NP_066285, 153aa-240aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITD
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged NR2F2 is approximately 10ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NR2F2 is approximately 10ng/ml as a capture antibody.)
Product Categories/Family for anti-NR2F2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,163 Da
NCBI Official Full Name
COUP transcription factor 2 isoform a
NCBI Official Synonym Full Names
nuclear receptor subfamily 2, group F, member 2
NCBI Official Symbol
NR2F2
NCBI Official Synonym Symbols
ARP1; CHTD4; NF-E3; NR2F1; SVP40; COUPTFB; TFCOUP2; COUPTFII
NCBI Protein Information
COUP transcription factor 2
UniProt Protein Name
COUP transcription factor 2
Protein Family
UniProt Gene Name
NR2F2
UniProt Synonym Gene Names
ARP1; TFCOUP2; COUP-TF2; ARP-1; COUP-TF II
UniProt Entry Name
COT2_HUMAN

NCBI Description

This gene encodes a member of the steroid thyroid hormone superfamily of nuclear receptors. The encoded protein is a ligand inducible transcription factor that is involved in the regulation of many different genes. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]

Uniprot Description

NR2F2: Ligand-activated transcription factor. Activated by high concentrations of 9-cis-retinoic acid and all-trans-retinoic acid, but not by dexamethasone, cortisol or progesterone (in vitro). Regulation of the apolipoprotein A-I gene transcription. Binds to DNA site A. Interacts with SQSTM1. Binds DNA as a dimer; homodimer or heterodimer with NR2F6. Interacts with NCOA1, NCOA2, NCOA3 and PPARGC1A. Interacts with ZFPM2. Ubiquitous. Belongs to the nuclear hormone receptor family. NR2 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Nuclear receptor; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 15q26

Cellular Component: nucleus

Molecular Function: ligand-dependent nuclear receptor activity; protein binding; protein homodimerization activity; retinoic acid binding; zinc ion binding; sequence-specific DNA binding; steroid hormone receptor activity; transcription corepressor activity; transcription factor activity

Biological Process: limb development; skeletal muscle development; intracellular receptor-mediated signaling pathway; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; neuron migration; negative regulation of cyclin-dependent protein kinase activity; negative regulation of transcription from RNA polymerase II promoter; signal transduction; response to estradiol stimulus; anterior/posterior pattern formation; regulation of transcription from RNA polymerase II promoter; fertilization; forebrain development; negative regulation of endothelial cell proliferation; blood vessel morphogenesis; steroid hormone mediated signaling; lipid metabolic process; negative regulation of transcription, DNA-dependent; radial pattern formation; maternal placenta development

Disease: Congenital Heart Defects, Multiple Types, 4

Research Articles on NR2F2

Similar Products

Product Notes

The NR2F2 nr2f2 (Catalog #AAA6181788) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NR2F2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NR2F2 nr2f2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NR2F2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.