Mouse anti-Human ADNP Monoclonal Antibody | anti-ADNP antibody

ADNP (Activity Dependent Neuroprotective Protein) (HRP)

Cat. Num. AAA6151108

• Gene Names: ADNP; ADNP1; HVDAS; MRD28
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ADNP; Monoclonal Antibody; ADNP (Activity Dependent Neuroprotective Protein) (HRP); anti-ADNP antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG3,k
• Clone Number: 6B8
• Specificity: Recognizes human ADNP.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-ADNP antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1018-1103 from DNP (NP_056154) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TMQGDREQLKWKNSSYGKVEGFWSKDQSQWKNASENDERLSNPQIEWQNSTIDSEDGEQFDNMTDGVAEPMHGSLAGVKLSSQQA*
• Conjugate: HRP
• Preparation and Storage: May be stored at 4 degree C. For long-term storage, aliquot and store at 4 degree C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.46kD).)

Related Product Information for anti-ADNP antibody

Vasoactive intestinal peptide is a neuroprotective factor that has a stimulatory effect on the growth of some tumor cells and an inhibitory effect on others. This gene encodes a protein that is upregulated by vasoactive intestinal peptide and may be involved in its stimulatory effect on certain tumor cells. The encoded protein contains one homeobox and nine zinc finger domains, suggesting that it functions as a transcription factor. This gene is also upregulated in normal proliferative tissues. Finally, the encoded protein may increase the viability of certain cell types through modulation of p53 activity. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq].

Product Categories/Family for anti-ADNP antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 12229217
• NCBI GeneID: 23394
• NCBI Accession #: NP_056154
• NCBI GenBank Nucleotide #: NM_015339
• UniProt Accession #: Q9H2P0; O94881; Q5BKU2; Q9UG34; E1P5Y2
• Molecular Weight: 123,563 Da
• NCBI Official Full Name: activity-dependent neuroprotector homeobox protein
• NCBI Official Synonym Full Names: activity-dependent neuroprotector homeobox
• NCBI Official Symbol: ADNP
• NCBI Official Synonym Symbols: ADNP1; HVDAS; MRD28
• NCBI Protein Information: activity-dependent neuroprotector homeobox protein
• UniProt Protein Name: Activity-dependent neuroprotector homeobox protein
• Protein Family: ADNP homeobox protein
• UniProt Gene Name: ADNP
• UniProt Synonym Gene Names: ADNP1; KIAA0784
• UniProt Entry Name: ADNP_HUMAN

NCBI Description

Vasoactive intestinal peptide is a neuroprotective factor that has a stimulatory effect on the growth of some tumor cells and an inhibitory effect on others. This gene encodes a protein that is upregulated by vasoactive intestinal peptide and may be involved in its stimulatory effect on certain tumor cells. The encoded protein contains one homeobox and nine zinc finger domains, suggesting that it functions as a transcription factor. This gene is also upregulated in normal proliferative tissues. Finally, the encoded protein may increase the viability of certain cell types through modulation of p53 activity. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

ADNP: Potential transcription factor. May mediate some of the neuroprotective peptide VIP-associated effects involving normal growth and cancer proliferation.

Protein type: Apoptosis; C2H2-type zinc finger protein; DNA-binding

Chromosomal Location of Human Ortholog: 20q13.13

Cellular Component: extracellular space; nucleus

Molecular Function: protein binding; DNA binding; metal ion binding; chromatin binding

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; negative regulation of neuron apoptosis

Disease: Mental Retardation, Autosomal Dominant 28