Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human NR2B Monoclonal Antibody | anti-NR2B antibody

NR2B (NMDA R2b, NMDAR2B, N-methyl-D-aspartate Receptor Subunit 3, GRIN2B, Glutamate [NMDA] Receptor Subunit epsilon-2, NR2B, N-methyl-D-aspartate Receptor Subunit 2B, NR3, MGC142178, MGC142180) (AP)

Gene Names
GRIN2B; MRD6; NR2B; hNR3; EIEE27; GluN2B; NMDAR2B
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NR2B; Monoclonal Antibody; NR2B (NMDA R2b; NMDAR2B; N-methyl-D-aspartate Receptor Subunit 3; GRIN2B; Glutamate [NMDA] Receptor Subunit epsilon-2; N-methyl-D-aspartate Receptor Subunit 2B; NR3; MGC142178; MGC142180) (AP); anti-NR2B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G5
Specificity
Recognizes human GRIN2B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-NR2B antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa127-236 from human GRIN2B (NP_000825) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQDFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEE
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Testing Data

(Detection limit for recombinant GST tagged GRIN2B is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GRIN2B is ~3ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CAPN1 and GRIN2B. HeLa cells were stained with CAPN1 rabbit purified polyclonal 1:1200 and GRIN2B mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between CAPN1 and GRIN2B. HeLa cells were stained with CAPN1 rabbit purified polyclonal 1:1200 and GRIN2B mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Product Categories/Family for anti-NR2B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
166,367 Da
NCBI Official Full Name
glutamate receptor ionotropic, NMDA 2B
NCBI Official Synonym Full Names
glutamate receptor, ionotropic, N-methyl D-aspartate 2B
NCBI Official Symbol
GRIN2B
NCBI Official Synonym Symbols
MRD6; NR2B; hNR3; EIEE27; GluN2B; NMDAR2B
NCBI Protein Information
glutamate receptor ionotropic, NMDA 2B; N-methyl D-aspartate receptor subtype 2B; N-methyl-D-aspartate receptor subunit 3; NR3; glutamate [NMDA] receptor subunit epsilon-2; glutamate receptor subunit epsilon-2
UniProt Protein Name
Glutamate receptor ionotropic, NMDA 2B
UniProt Gene Name
GRIN2B
UniProt Synonym Gene Names
NMDAR2B; GluN2B; NMDAR2B; NR2B; NR3; hNR3
UniProt Entry Name
NMDE2_HUMAN

Uniprot Description

NMDAR2B: an NMDA receptor subtype of glutamate-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Mediated by glycine. Plays a key role in synaptic plasticity, synaptogenesis, excitotoxicity, memory acquisition and learning. Mediates neuronal functions in glutamate neurotransmission. In concert with DAPK1 at extrasynaptic sites, acts as a central mediator for stroke damage. Its phosphorylation at Ser-1303 by DAPK1 enhances synaptic NMDA receptor channel activity inducing injurious Ca2+ influx through them, resulting in an irreversible neuronal death.

Protein type: Channel, calcium; Membrane protein, integral; Channel, ligand-gated; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 12p12

Cellular Component: postsynaptic membrane; synaptic vesicle; neuron projection; cell surface; integral to plasma membrane; dendrite; plasma membrane; cell junction; N-methyl-D-aspartate selective glutamate receptor complex

Molecular Function: protein binding; extracellular-glutamate-gated ion channel activity; zinc ion binding; glycine binding; calcium channel activity; N-methyl-D-aspartate selective glutamate receptor activity

Biological Process: axon guidance; synaptic transmission, glutamatergic; behavioral fear response; startle response; in utero embryonic development; glutamate signaling pathway; regulation of synaptic plasticity; learning; memory; detection of mechanical stimulus involved in sensory perception of pain; synaptic transmission; behavioral response to pain; response to ethanol; sensory organ development; learning and/or memory; suckling behavior; transport; ionotropic glutamate receptor signaling pathway; ephrin receptor signaling pathway; regulation of excitatory postsynaptic membrane potential

Disease: Epileptic Encephalopathy, Early Infantile, 27; Mental Retardation, Autosomal Dominant 6

Similar Products

Product Notes

The NR2B grin2b (Catalog #AAA6132645) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NR2B (NMDA R2b, NMDAR2B, N-methyl-D-aspartate Receptor Subunit 3, GRIN2B, Glutamate [NMDA] Receptor Subunit epsilon-2, NR2B, N-methyl-D-aspartate Receptor Subunit 2B, NR3, MGC142178, MGC142180) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NR2B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NR2B grin2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NR2B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.