Mouse NPM1 Monoclonal Antibody | anti-NPM1 antibody

NPM1 (Nucleophosmin (Nucleolar Phosphoprotein B23, Numatrin), B23, MGC104254, NPM) (PE)

Cat. Num. AAA6187015

• Gene Names: NPM1; B23; NPM
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: NPM1; Monoclonal Antibody; NPM1 (Nucleophosmin (Nucleolar Phosphoprotein B23; Numatrin); B23; MGC104254; NPM) (PE); Nucleophosmin (Nucleolar Phosphoprotein B23; NPM; anti-NPM1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1B11
• Specificity: Recognizes NPM1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 294

• Applicable Applications for anti-NPM1 antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: NPM1 (AAH02398.1, 1aa-294aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged NPM1 is 0.3 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to NPM1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to NPM1 on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-NPM1 antibody

NPM1 is a ubiquitously expressed nucleolar protein that shuttles between the nucleus and cytoplasm. It is implicated in multiple functions, including ribosomal protein assembly and transport, control of centrosome duplication, and regulation of the tumor suppressor ARF (MIM 600160). NPM1 mutations that relocalize NPM1 from the nucleus into the cytoplasm are associated with development of acute myeloid leukemia (AML; MIM 601626) (Garzon et al., 2008 [PubMed 18308931]). [supplied by OMIM]

Product Categories/Family for anti-NPM1 antibody

Antibodies; Nuclear Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 12803185
• NCBI GeneID: 4869
• NCBI Official Full Name: Nucleophosmin (nucleolar phosphoprotein B23, numatrin)
• NCBI Official Synonym Full Names: nucleophosmin 1
• NCBI Official Symbol: NPM1
• NCBI Official Synonym Symbols: B23; NPM
• NCBI Protein Information: nucleophosmin
• Protein Family: Nucleophosmin

NCBI Description

The protein encoded by this gene is involved in several cellular processes, including centrosome duplication, protein chaperoning, and cell proliferation. The encoded phosphoprotein shuttles between the nucleolus, nucleus, and cytoplasm, chaperoning ribosomal proteins and core histones from the nucleus to the cytoplasm. This protein is also known to sequester the tumor suppressor ARF in the nucleolus, protecting it from degradation until it is needed. Mutations in this gene are associated with acute myeloid leukemia. Dozens of pseudogenes of this gene have been identified. [provided by RefSeq, Aug 2017]