Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (33.66kD).)

Mouse NODAL Monoclonal Antibody | anti-NODAL antibody

NODAL (Nodal Homolog, MGC138230) (Biotin)

Gene Names
NODAL; HTX5
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NODAL; Monoclonal Antibody; NODAL (Nodal Homolog; MGC138230) (Biotin); anti-NODAL antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5C3
Specificity
Recognizes human NODAL. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-NODAL antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa275-347 from human NODAL (NP_060525) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGC
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.66kD).)

Western Blot (WB) (Western Blot detection against Immunogen (33.66kD).)

Western Blot (WB)

(NODAL monoclonal antibody Western Blot analysis of NODAL expression in HeLa.)

Western Blot (WB) (NODAL monoclonal antibody Western Blot analysis of NODAL expression in HeLa.)

Western Blot (WB)

(NODAL monoclonal antibody Western Blot analysis of NODAL expression in PC-12.)

Western Blot (WB) (NODAL monoclonal antibody Western Blot analysis of NODAL expression in PC-12.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to NODAL on formalin-fixed paraffin-embedded human endometrium cancer. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to NODAL on formalin-fixed paraffin-embedded human endometrium cancer. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to NODAL on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to NODAL on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged NODAL is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NODAL is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-NODAL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,561 Da
NCBI Official Full Name
nodal homolog
NCBI Official Synonym Full Names
nodal growth differentiation factor
NCBI Official Symbol
NODAL
NCBI Official Synonym Symbols
HTX5
NCBI Protein Information
nodal homolog
UniProt Protein Name
Nodal homolog
Protein Family
UniProt Gene Name
NODAL
UniProt Entry Name
NODAL_HUMAN

Uniprot Description

NODAL: Essential for mesoderm formation and axial patterning during embryonic development. Defects in NODAL are the cause of visceral heterotaxy autosomal type 5 (HTX5). A form of visceral heterotaxy, a complex disorder due to disruption of the normal left-right asymmetry of the thoracoabdominal organs. It results in an abnormal arrangement of visceral organs, and a wide variety of congenital defects. Clinical features of visceral heterotaxy autosomal type 5 include situs inversus viscerum or situs ambiguus, congenital heart defect, transposition of the great vessels ventricular septal defect, atrial septal defect, truncuscommunis, and dextrocardia. Belongs to the TGF-beta family.

Protein type: Cytokine; Cell development/differentiation; Motility/polarity/chemotaxis; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 10q22.1

Cellular Component: extracellular space

Molecular Function: morphogen activity; growth factor activity; cytokine activity; receptor agonist activity; transforming growth factor beta receptor binding

Biological Process: embryonic placenta development; mesendoderm development; positive regulation of caspase activity; negative regulation of transcription from RNA polymerase II promoter; axial mesodermal cell fate specification; embryonic pattern specification; positive regulation of activin receptor signaling pathway; floor plate morphogenesis; vasculature development; regulation of gastrulation; positive regulation of cell-cell adhesion; trophectodermal cellular morphogenesis; heart looping; cell migration involved in gastrulation; maternal placenta development; placenta development; embryonic process involved in female pregnancy; stem cell maintenance; digestive tract morphogenesis; embryonic cranial skeleton morphogenesis; liver development; formation of anatomical boundary; neural fold formation; positive regulation of angiogenesis; repression of premature neural plate formation; polarity specification of proximal/distal axis; maternal process involved in parturition; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription factor activity; brain development; positive regulation of epithelial cell proliferation; growth

Disease: Heterotaxy, Visceral, 5, Autosomal

Similar Products

Product Notes

The NODAL nodal (Catalog #AAA6143218) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NODAL (Nodal Homolog, MGC138230) (Biotin) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NODAL can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NODAL nodal for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NODAL, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.