Mouse anti-Human Nocturnin Monoclonal Antibody | anti-NOC antibody

Nocturnin (CCRN4L, CCR4 Protein Homolog, NOC, CCR4) (HRP)

Cat. Num. AAA6153822

• Gene Names: NOCT; NOC; CCR4L; Ccr4c; CCRN4L
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Nocturnin; Monoclonal Antibody; Nocturnin (CCRN4L; CCR4 Protein Homolog; NOC; CCR4) (HRP); anti-NOC antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3E8
• Specificity: Recognizes human CCRN4L.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-NOC antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa64-153 from human CCRN4L (NP_036250) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VCSMGTGTSRLYSALAKTLNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRFQRDFVDLRTDCPSTHPPIRVMQWNILA*
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.9kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CCRN4L on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

Product Categories/Family for anti-NOC antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 31083028
• NCBI GeneID: 25819
• NCBI Accession #: NP_036250
• NCBI GenBank Nucleotide #: NM_012118
• UniProt Accession #: Q9UK39
• Molecular Weight: 48kDa
• NCBI Official Full Name: nocturnin
• NCBI Official Synonym Full Names: nocturnin
• NCBI Official Symbol: NOCT
• NCBI Official Synonym Symbols: NOC; CCR4L; Ccr4c; CCRN4L
• NCBI Protein Information: nocturnin
• UniProt Protein Name: Nocturnin
• Protein Family: Nocturnin
• UniProt Gene Name: NOCT

NCBI Description

The protein encoded by this gene is highly similar to Nocturnin, a gene identified as a circadian clock regulated gene in Xenopus laevis. This protein and Nocturnin protein share similarity with the C-terminal domain of a yeast transcription factor, carbon catabolite repression 4 (CCR4). The mRNA abundance of a similar gene in mouse has been shown to exhibit circadian rhythmicity, which suggests a role for this protein in clock function or as a circadian clock effector. [provided by RefSeq, Jul 2008]

Uniprot Description

Circadian deadenylase which plays an important role in post-transcriptional regulation of metabolic genes under circadian control. Degrades poly(A) tails of specific target mRNAs leading to their degradation and suppression of translation. Exerts a rhythmic post-transcriptional control of genes necessary for metabolic functions including nutrient absorption, glucose/insulin sensitivity, lipid metabolism, adipogenesis, inflammation and osteogenesis. Plays an important role in favoring adipogenesis over osteoblastogenesis and acts as a key regulator of the adipogenesis/osteogenesis balance. Promotes adipogenesis by activating PPARG transcriptional activity in a deadenylase-independent manner by facilitating its nuclear translocation. Regulates circadian expression of NOS2 in the liver and negatively regulates the circadian expression of IGF1 in the bone. Critical for proper development of early embryos ().