Mouse anti-Human NME7 Monoclonal Antibody | anti-NME7 antibody

NME7 (Nucleoside Diphosphate Kinase 7, NDK 7, NDP Kinase 7, nm23-H7, FLJ37194, MN23H7)

Cat. Num. AAA646582

• Gene Names: NME7; NDK7; NDK 7; MN23H7; nm23-H7
• Reactivity: Human
• Applications: ELISA
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: NME7; Monoclonal Antibody; NME7 (Nucleoside Diphosphate Kinase 7; NDK 7; NDP Kinase 7; nm23-H7; FLJ37194; MN23H7); Anti -NME7 (Nucleoside Diphosphate Kinase 7; anti-NME7 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1A11
• Specificity: Recognizes human NME7.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: DRVNVEEFYEVYKGVVTEYHDMVTEMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLPEDGLLEVQYFFKIL*

• Applicable Applications for anti-NME7 antibody: ELISA (EL/EIA)
• Application Notes: Suitable for use in ELISA.
• Immunogen: Partial recombinant corresponding to aa277-375 from human NME7 with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Related Product Information for anti-NME7 antibody

Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the g phosphate of ATP, onto an acceptor amino acid in a substrate protein. By this basic mechanism, protein kinases mediate most of the signal transduction in eukaryotic cells, regulating cellular metabolism, transcription, cell cycle progression, cytoskeletal rearrangement and cell movement, apoptosis, and differentiation. With more than 500 gene products, the protein kinase family is one of the largest families of proteins in eukaryotes. The family has been classified in 8 major groups based on sequence comparison of their tyrosine (PTK) or serine/threonine (STK) kinase catalytic domains. The STE group (homologs of yeast Sterile 7, 11, 20 kinases) consists of 50 kinases related to the mitogen-activated protein kinase (MAPK) cascade families (Ste7/MAP2K, Ste11/MAP3K, and Ste20/MAP4K). MAP kinase cascades, consisting of a MAPK and one or more upstream regulatory kinases (MAPKKs) have been best characterized in the yeast pheromone response pathway. Pheromones bind to Ste cell surface receptors and activate yeast MAPK pathway.

Product Categories/Family for anti-NME7 antibody

Antibodies; Abs to Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 37574614
• NCBI GeneID: 29922
• NCBI Accession #: NP_932076.1
• NCBI GenBank Nucleotide #: NM_197972.2
• UniProt Accession #: Q9Y5B8; Q5TGZ4; A8K3T6; A8MY09; B3KSW9
• Molecular Weight: 42,492 Da
• NCBI Official Full Name: nucleoside diphosphate kinase 7 isoform b
• NCBI Official Synonym Full Names: NME/NM23 family member 7
• NCBI Official Symbol: NME7
• NCBI Official Synonym Symbols: NDK7; NDK 7; MN23H7; nm23-H7
• NCBI Protein Information: nucleoside diphosphate kinase 7; NDP kinase 7; nucleoside-diphosphate kinase 7; non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase)
• UniProt Protein Name: Nucleoside diphosphate kinase 7
• Protein Family: Nucleoside diphosphate kinase
• UniProt Gene Name: NME7
• UniProt Synonym Gene Names: NDK 7
• UniProt Entry Name: NDK7_HUMAN

Uniprot Description

Function: Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.

Catalytic activity: ATP + nucleoside diphosphate = ADP + nucleoside triphosphate.

Cofactor: Magnesium

By similarity.

Sequence similarities: Belongs to the NDK family.Contains 1 DM10 domain.