Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to NME2 on HeLa cell. [antibody concentration 10 ug/ml])

Mouse NME2 Monoclonal Antibody | anti-NME2 antibody

NME2 (Non-Metastatic Cells 2, Protein (NM23B) Expressed in, MGC111212, NDPK-B, NDPKB, NM23-H2, NM23B, puf) (Biotin)

Gene Names
NME2; PUF; NDKB; NDPKB; NM23B; NDPK-B; NM23-H2
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
NME2; Monoclonal Antibody; NME2 (Non-Metastatic Cells 2; Protein (NM23B) Expressed in; MGC111212; NDPK-B; NDPKB; NM23-H2; NM23B; puf) (Biotin); Non-Metastatic Cells 2; puf; anti-NME2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
10000
Specificity
Recognizes NME2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
152
Applicable Applications for anti-NME2 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NME2 (NP_002503, 51aa-152aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
Conjugate
Biotin
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to NME2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to NME2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to NME2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to NME2 on HeLa cell. [antibody concentration 10 ug/ml])

Western Blot (WB)

(NME2 monoclonal antibody (M11), clone 1E4 Western Blot analysis of NME2 expression in HeLa.)

Western Blot (WB) (NME2 monoclonal antibody (M11), clone 1E4 Western Blot analysis of NME2 expression in HeLa.)

Testing Data

(Detection limit for recombinant GST tagged NME2 is approximately 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NME2 is approximately 1ng/ml as a capture antibody.)

Western Blot (WB)

(NME2 monoclonal antibody (M11), clone 1E4. Western Blot analysis of NME2 expression in NIH/3T3.)

Western Blot (WB) (NME2 monoclonal antibody (M11), clone 1E4. Western Blot analysis of NME2 expression in NIH/3T3.)

Western Blot (WB)

(NME2 monoclonal antibody (M11), clone 1E4. Western Blot analysis of NME2 expression in PC-12.)

Western Blot (WB) (NME2 monoclonal antibody (M11), clone 1E4. Western Blot analysis of NME2 expression in PC-12.)
Related Product Information for anti-NME2 antibody
Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by NME1) and 'B' (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants encoding the same isoform have been found for this gene. Co-transcription of this gene and the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) which encode a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq]
Product Categories/Family for anti-NME2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
nucleoside diphosphate kinase B isoform a
NCBI Official Synonym Full Names
NME/NM23 nucleoside diphosphate kinase 2
NCBI Official Symbol
NME2
NCBI Official Synonym Symbols
PUF; NDKB; NDPKB; NM23B; NDPK-B; NM23-H2
NCBI Protein Information
nucleoside diphosphate kinase B
UniProt Protein Name
Nucleoside diphosphate kinase B
UniProt Gene Name
NME2
UniProt Synonym Gene Names
NM23B; NDK B; NDP kinase B
UniProt Entry Name
NDKB_HUMAN

NCBI Description

Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by NME1) and 'B' (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants have been found for this gene. Read-through transcription from the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) that encode a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq, Nov 2010]

Uniprot Description

NME2: Major role in the synthesis of nucleoside triphosphates other than ATP. Negatively regulates Rho activity by interacting with AKAP13/LBC. Acts as a transcriptional activator of the MYC gene; binds DNA non-specifically (PubMed:8392752). Exhibits histidine protein kinase activity. Belongs to the NDK family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Kinase, other; Nucleotide Metabolism - pyrimidine; EC 2.7.13.3; Nucleotide Metabolism - purine; Nuclear receptor co-regulator; EC 2.7.4.6; Kinase, nucleoside diphosphate; Other group; NDK family

Chromosomal Location of Human Ortholog: 17q21.3

Cellular Component: ruffle; centrosome; focal adhesion; membrane; mitochondrion; perinuclear region of cytoplasm; lamellipodium; cytoplasm; intermediate filament; cytosol; nucleus

Molecular Function: gamma-tubulin binding; protein binding; protein histidine kinase activity; metal ion binding; nucleoside diphosphate kinase activity; intermediate filament binding; protein kinase binding; transcription factor activity; ATP binding; single-stranded DNA binding

Biological Process: integrin-mediated signaling pathway; GTP biosynthetic process; peptidyl-histidine phosphorylation; response to cAMP; transcription, DNA-dependent; nucleobase, nucleoside and nucleotide interconversion; nucleobase, nucleoside and nucleotide metabolic process; negative regulation of myeloid leukocyte differentiation; UTP biosynthetic process; hippocampus development; nucleoside diphosphate phosphorylation; response to testosterone stimulus; CTP biosynthetic process; regulation of transcription, DNA-dependent; pyrimidine nucleotide metabolic process; nucleoside triphosphate biosynthetic process; positive regulation of transcription from RNA polymerase II promoter; cell adhesion; positive regulation of epithelial cell proliferation; regulation of epidermis development; response to amine stimulus; positive regulation of keratinocyte differentiation; purine nucleotide metabolic process; negative regulation of apoptosis

Research Articles on NME2

Similar Products

Product Notes

The NME2 nme2 (Catalog #AAA6172363) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NME2 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NME2 nme2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NME2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.