Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse NME1 Monoclonal Antibody | anti-NME1 antibody

NME1 (Non-Metastatic Cells 1, Protein (NM23A) Expressed in, AWD, GAAD, NB, NBS, NDPK-A, NDPKA, NM23, NM23-H1) (MaxLight 490)

Gene Names
NME1; NB; AWD; NBS; GAAD; NDKA; NM23; NDPKA; NDPK-A; NM23-H1
Applications
Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
NME1; Monoclonal Antibody; NME1 (Non-Metastatic Cells 1; Protein (NM23A) Expressed in; AWD; GAAD; NB; NBS; NDPK-A; NDPKA; NM23; NM23-H1) (MaxLight 490); Non-Metastatic Cells 1; NM23-H1; anti-NME1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D7
Specificity
Recognizes NME1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-NME1 antibody
Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NME1 (NP_000260, 43aa-152aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-NME1 antibody
This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in this gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq]
Product Categories/Family for anti-NME1 antibody
References
1. Identification of Antigenic Proteins Associated with Trichloroethylene-Induced Autoimmune Disease by Serological Proteome Analysis.Liu J, Xing X, Huang H, Jiang Y, He H, Xu X, Yuan J, Zhou L, Yang L, Zhuang Z.Toxicol Appl Pharmacol. 2009 Nov 1;240(3):393-400. Epub 2009 Aug 6.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,137 Da
NCBI Official Full Name
nucleoside diphosphate kinase A isoform b
NCBI Official Synonym Full Names
NME/NM23 nucleoside diphosphate kinase 1
NCBI Official Symbol
NME1
NCBI Official Synonym Symbols
NB; AWD; NBS; GAAD; NDKA; NM23; NDPKA; NDPK-A; NM23-H1
NCBI Protein Information
nucleoside diphosphate kinase A
UniProt Protein Name
Nucleoside diphosphate kinase A
UniProt Gene Name
NME1
UniProt Synonym Gene Names
NDPKA; NM23; NDK A; NDP kinase A; GAAD
UniProt Entry Name
NDKA_HUMAN

NCBI Description

This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in this gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq, Jul 2008]

Uniprot Description

NME1: an enzyme with multiple activities including histidine protein kinase, nucleoside-diphosphate kinase, serine/threonine-specific protein kinase, geranyl and farnesyl pyrophosphate kinase and 3'-5' exonuclease activities. Plays a major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Involved in cell proliferation, differentiation and development, G protein-coupled receptor endocytosis, cytotoxic T cell and NK cell-mediated cell death, and gene expression. Required for neural development including neural patterning and cell fate determination. During granzyme A (GZMA)-mediated cell death, works in concert with TREX1. NME1 nicks one strand of DNA and TREX1 removes bases from the free 3' end to enhance DNA damage and prevent DNA end reannealing and rapid repair. Three alternatively spliced human proteins have been reported.

Protein type: Nucleotide Metabolism - purine; Kinase, nucleoside diphosphate; Kinase, other; EC 2.7.4.6; Tumor suppressor; Protein kinase, histidine; Nucleotide Metabolism - pyrimidine; Other group; NDK family

Chromosomal Location of Human Ortholog: 17q21.3

Cellular Component: mitochondrion; membrane; cytoplasm; nucleus; cytosol

Molecular Function: identical protein binding; protein binding; GTP binding; deoxyribonuclease activity; nucleoside diphosphate kinase activity; magnesium ion binding; ATP binding; ribosomal small subunit binding

Biological Process: GTP biosynthetic process; nervous system development; nucleobase, nucleoside and nucleotide interconversion; nucleobase, nucleoside and nucleotide metabolic process; UTP biosynthetic process; nucleoside diphosphate phosphorylation; endocytosis; DNA catabolic process; regulation of apoptosis; negative regulation of cell proliferation; CTP biosynthetic process; pyrimidine nucleotide metabolic process; nucleoside triphosphate biosynthetic process; cell differentiation; positive regulation of epithelial cell proliferation; positive regulation of DNA binding; purine nucleotide metabolic process

Disease: Neuroblastoma, Susceptibility To

Research Articles on NME1

Similar Products

Product Notes

The NME1 nme1 (Catalog #AAA6207611) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NME1 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NME1 nme1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NME1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.