Mouse NME1 Monoclonal Antibody | anti-NME1 antibody

NME1 (Non-Metastatic Cells 1, Protein (NM23A) Expressed in, AWD, GAAD, NB, NBS, NDPK-A, NDPKA, NM23, NM23-H1) (FITC)

Cat. Num. AAA6174909

• Gene Names: NME1; NB; AWD; NBS; GAAD; NDKA; NM23; NDPKA; NDPK-A; NM23-H1
• Applications: Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified
• Synonyms: NME1; Monoclonal Antibody; NME1 (Non-Metastatic Cells 1; Protein (NM23A) Expressed in; AWD; GAAD; NB; NBS; NDPK-A; NDPKA; NM23; NM23-H1) (FITC); Non-Metastatic Cells 1; NM23-H1; anti-NME1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1D7
• Specificity: Recognizes NME1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-NME1 antibody: Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: NME1 (NP_000260, 43aa-152aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to NME1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to NME1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to NME1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to NME1 on HeLa cell. [antibody concentration 10 ug/ml])

Western Blot (WB)

(NME1 monoclonal antibody (M02), clone 1D7. Western Blot analysis of NME1 expression in different cell lines.)

Testing Data

(Detection limit for recombinant GST tagged NME1 is approximately 0.1ng/ml as a capture antibody.)

Related Product Information for anti-NME1 antibody

This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in this gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq]

Product Categories/Family for anti-NME1 antibody

Antibodies; Protein Kinases

References

1. Identification of Antigenic Proteins Associated with Trichloroethylene-Induced Autoimmune Disease by Serological Proteome Analysis.Liu J, Xing X, Huang H, Jiang Y, He H, Xu X, Yuan J, Zhou L, Yang L, Zhuang Z.Toxicol Appl Pharmacol. 2009 Nov 1;240(3):393-400. Epub 2009 Aug 6.

NCBI and Uniprot Product Information

• NCBI GI #: 4557797
• NCBI GeneID: 4830
• NCBI Accession #: NP_000260
• NCBI GenBank Nucleotide #: NM_000269.2
• UniProt Accession #: P15531; Q6FGK3; Q86XQ2; Q9UDJ6
• Molecular Weight: 30,137 Da
• NCBI Official Full Name: nucleoside diphosphate kinase A isoform b
• NCBI Official Synonym Full Names: NME/NM23 nucleoside diphosphate kinase 1
• NCBI Official Symbol: NME1
• NCBI Official Synonym Symbols: NB; AWD; NBS; GAAD; NDKA; NM23; NDPKA; NDPK-A; NM23-H1
• NCBI Protein Information: nucleoside diphosphate kinase A
• UniProt Protein Name: Nucleoside diphosphate kinase A
• Protein Family: Nucleoside diphosphate kinase
• UniProt Gene Name: NME1
• UniProt Synonym Gene Names: NDPKA; NM23; NDK A; NDP kinase A; GAAD
• UniProt Entry Name: NDKA_HUMAN

NCBI Description

This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in this gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq, Jul 2008]

Uniprot Description

NME1: an enzyme with multiple activities including histidine protein kinase, nucleoside-diphosphate kinase, serine/threonine-specific protein kinase, geranyl and farnesyl pyrophosphate kinase and 3'-5' exonuclease activities. Plays a major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Involved in cell proliferation, differentiation and development, G protein-coupled receptor endocytosis, cytotoxic T cell and NK cell-mediated cell death, and gene expression. Required for neural development including neural patterning and cell fate determination. During granzyme A (GZMA)-mediated cell death, works in concert with TREX1. NME1 nicks one strand of DNA and TREX1 removes bases from the free 3' end to enhance DNA damage and prevent DNA end reannealing and rapid repair. Three alternatively spliced human proteins have been reported.

Protein type: Nucleotide Metabolism - purine; Kinase, nucleoside diphosphate; Kinase, other; EC 2.7.4.6; Tumor suppressor; Protein kinase, histidine; Nucleotide Metabolism - pyrimidine; Other group; NDK family

Chromosomal Location of Human Ortholog: 17q21.3

Cellular Component: mitochondrion; membrane; cytoplasm; nucleus; cytosol

Molecular Function: identical protein binding; protein binding; GTP binding; deoxyribonuclease activity; nucleoside diphosphate kinase activity; magnesium ion binding; ATP binding; ribosomal small subunit binding

Biological Process: GTP biosynthetic process; nervous system development; nucleobase, nucleoside and nucleotide interconversion; nucleobase, nucleoside and nucleotide metabolic process; UTP biosynthetic process; nucleoside diphosphate phosphorylation; endocytosis; DNA catabolic process; regulation of apoptosis; negative regulation of cell proliferation; CTP biosynthetic process; pyrimidine nucleotide metabolic process; nucleoside triphosphate biosynthetic process; cell differentiation; positive regulation of epithelial cell proliferation; positive regulation of DNA binding; purine nucleotide metabolic process

Disease: Neuroblastoma, Susceptibility To