Mouse anti-Human NIT1 Monoclonal Antibody | anti-NIT1 antibody

NIT1 (Nitrilase Homolog 1, MGC57670) (PE)

Cat. Num. AAA6159098

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NIT1; Monoclonal Antibody; NIT1 (Nitrilase Homolog 1; MGC57670) (PE); anti-NIT1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1C3
• Specificity: Recognizes human NIT1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-NIT1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa228-328 from human NIT1 (NP_005591) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: AFGSITGPAHWEVLLRARAIETQCYVVAAAQCGRHHEKRASYGHSMVVDPWGTVVARCSEGPGLCLARIDLNYLRQLRRHLPVFQHRRPDLYGNLGHPLS
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of NIT1 expression in transfected 293T cell line by NIT1 monoclonal antibody. Lane 1: NIT1 transfected lysate (Predicted MW: 35.9kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of NIT1 transfected lysate using NIT1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NIT1 monoclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged NIT1 is 1ng/ml as a capture antibody.)

Product Categories/Family for anti-NIT1 antibody

Antibodies; Apoptosis

NCBI and Uniprot Product Information

• NCBI GI #: 5031947
• NCBI GeneID: 4817
• NCBI Accession #: NP_005591
• NCBI GenBank Nucleotide #: NM_005600
• UniProt Accession #: Q86X76; O76091; B1AQP3; D3DVF4
• Molecular Weight: 26,326 Da
• NCBI Official Full Name: nitrilase homolog 1 isoform 1
• NCBI Official Synonym Full Names: nitrilase 1
• NCBI Official Symbol: NIT1
• NCBI Protein Information: nitrilase homolog 1
• UniProt Protein Name: Nitrilase homolog 1
• Protein Family: Nitrilase
• UniProt Gene Name: NIT1
• UniProt Entry Name: NIT1_HUMAN

NCBI Description

This gene encodes a member of the nitrilase protein family with homology to bacterial and plant nitrilases, enzymes that cleave nitriles and organic amides to the corresponding carboxylic acids plus ammonia. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]

Uniprot Description

NIT1: Plays a role in cell growth and apoptosis: loss of expression promotes cell growth and resistance to DNA damage stress. Has tumor suppressor properties that enhances the apoptotic responsiveness in cancer cells; this effect is additive to the tumor suppressor activity of FHIT. It is also a negative regulator of primary T-cells. Has apparently no omega-amidase activity such as NIT2. Belongs to the UPF0012 family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.5.-.-; Hydrolase

Chromosomal Location of Human Ortholog: 1q21-q22

Cellular Component: mitochondrion; nucleus

Molecular Function: nitrilase activity

Biological Process: nitrogen compound metabolic process