Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human NIPP1 Monoclonal Antibody | anti-NIPP1 antibody

NIPP1 (Nuclear Inhibitor of Protein Phosphatase 1, NIPP-1, Protein Phosphatase 1 Regulatory Inhibitor Subunit 8, ARD1, PPP1R8) (FITC)

Gene Names
PPP1R8; ARD1; ARD-1; NIPP1; NIPP-1; PRO2047
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NIPP1; Monoclonal Antibody; NIPP1 (Nuclear Inhibitor of Protein Phosphatase 1; NIPP-1; Protein Phosphatase 1 Regulatory Inhibitor Subunit 8; ARD1; PPP1R8) (FITC); anti-NIPP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4B5
Specificity
Recognizes human PPP1R8.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-NIPP1 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa28-127 from human PPP1R8 (NP_002704.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of PPP1R8 expression in transfected 293T cell line by PPP1R8 monoclonal antibody. Lane 1: PPP1R8 transfected lysate (Predicted MW: 38.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PPP1R8 expression in transfected 293T cell line by PPP1R8 monoclonal antibody. Lane 1: PPP1R8 transfected lysate (Predicted MW: 38.5kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of PPP1R8 transfected lysate using PPP1R8 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PPP1R8 monoclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of PPP1R8 transfected lysate using PPP1R8 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PPP1R8 monoclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged PPP1R8 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PPP1R8 is ~3ng/ml as a capture antibody.)
Related Product Information for anti-NIPP1 antibody
Inhibitor subunit of the major nuclear protein phosphatase-1 (PP-1). It has RNA-binding activity but does not cleave RNA and may target PP-1 to RNA-associated substrates. May also be involved in pre-mRNA splicing. Binds DNA and might act as a transcriptional repressor. Seems to be required for cell proliferation. Isoform Gamma is a site-specific single-strand endoribonuclease that cleaves single strand RNA 3' to purines and pyrimidines in A+U-rich regions. It generates 5'-phosphate termini at the site of cleavage. This isoform does not inhibit PP-1. May be implicated in mRNA splicing.
Product Categories/Family for anti-NIPP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,479 Da
NCBI Official Full Name
nuclear inhibitor of protein phosphatase 1 isoform gamma
NCBI Official Synonym Full Names
protein phosphatase 1, regulatory subunit 8
NCBI Official Symbol
PPP1R8
NCBI Official Synonym Symbols
ARD1; ARD-1; NIPP1; NIPP-1; PRO2047
NCBI Protein Information
nuclear inhibitor of protein phosphatase 1; RNase E; activator of RNA decay; nuclear subunit of PP-1; protein phosphatase 1 regulatory subunit 8; nuclear inhibitor of protein phosphatase-1 alpha; protein phosphatase 1, regulatory (inhibitor) subunit 8
UniProt Protein Name
Nuclear inhibitor of protein phosphatase 1
UniProt Gene Name
PPP1R8
UniProt Synonym Gene Names
ARD1; NIPP1; NIPP-1
UniProt Entry Name
PP1R8_HUMAN

NCBI Description

This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA. [provided by RefSeq, Jul 2008]

Uniprot Description

NIPP-1: Inhibitor subunit of the major nuclear protein phosphatase-1 (PP-1). It has RNA-binding activity but does not cleave RNA and may target PP-1 to RNA-associated substrates. May also be involved in pre-mRNA splicing. Binds DNA and might act as a transcriptional repressor. Seems to be required for cell proliferation. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Inhibitor; EC 3.1.4.-; Motility/polarity/chemotaxis; Protein phosphatase, regulatory subunit; Ribonuclease

Chromosomal Location of Human Ortholog: 1p35.3

Cellular Component: nucleoplasm; spliceosome; cytoplasm; nuclear speck; nucleus

Molecular Function: protein binding; DNA binding; ribonuclease E activity; RNA binding; protein phosphatase type 1 regulator activity; endonuclease activity; type 1 serine/threonine specific protein phosphatase inhibitor activity

Biological Process: cell proliferation; regulation of transcription, DNA-dependent; transcription, DNA-dependent; RNA splicing; RNA catabolic process; negative regulation of catalytic activity; mRNA processing

Research Articles on NIPP1

Similar Products

Product Notes

The NIPP1 ppp1r8 (Catalog #AAA6148489) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NIPP1 (Nuclear Inhibitor of Protein Phosphatase 1, NIPP-1, Protein Phosphatase 1 Regulatory Inhibitor Subunit 8, ARD1, PPP1R8) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NIPP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NIPP1 ppp1r8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NIPP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.