Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.93kD).)

Mouse anti-Human EML4 Monoclonal Antibody | anti-EML4 antibody

EML4 (Echinoderm Microtubule-associated Protein-like 4, EMAP-4, Restrictedly Overexpressed Proliferation-associated Protein, Ropp 120, C2orf2, EMAPL4) APC

Gene Names
EML4; C2orf2; ELP120; EMAP-4; EMAPL4; ROPP120
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EML4; Monoclonal Antibody; EML4 (Echinoderm Microtubule-associated Protein-like 4; EMAP-4; Restrictedly Overexpressed Proliferation-associated Protein; Ropp 120; C2orf2; EMAPL4) APC; anti-EML4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3C10
Specificity
Recognizes human EML4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-EML4 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-63 from human EML4 (AAH08685) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MCYTPCKKYTDMNRQFLEKKEHFFKYLGNTALSDQQGVYLRTSVTFGVAMYNEIYNHDTLRW*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.93kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.93kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to EML4 on formalin-fixed paraffin-embedded human prostate cancer. [antibody concentration 10ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to EML4 on formalin-fixed paraffin-embedded human prostate cancer. [antibody concentration 10ug/ml])
Product Categories/Family for anti-EML4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
102,444 Da
NCBI Official Full Name
Homo sapiens echinoderm microtubule associated protein like 4, mRNA
NCBI Official Synonym Full Names
echinoderm microtubule associated protein like 4
NCBI Official Symbol
EML4
NCBI Official Synonym Symbols
C2orf2; ELP120; EMAP-4; EMAPL4; ROPP120
NCBI Protein Information
echinoderm microtubule-associated protein-like 4

NCBI Description

This gene is a member of the echinoderm microtubule associated protein-like family. The encoded WD-repeat protein may be involved in microtubule formation. Abnormal fusion of parts of this gene with portions of the anaplastic lymphoma receptor tyrosine kinase gene, which generates EML4-ALK fusion transcripts, is one of the primary mutations associated with non-small cell lung cancer. Alternative splicing of this gene results in two transcript variants. [provided by RefSeq, Jan 2015]

Research Articles on EML4

Similar Products

Product Notes

The EML4 (Catalog #AAA6136418) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EML4 (Echinoderm Microtubule-associated Protein-like 4, EMAP-4, Restrictedly Overexpressed Proliferation-associated Protein, Ropp 120, C2orf2, EMAPL4) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EML4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EML4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EML4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.