Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human NID1 Monoclonal Antibody | anti-NID1 antibody

NID1 (Nidogen 1, NID, NID-1, Nidogen-1, Entactin) (Biotin)

Gene Names
NID1; NID
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NID1; Monoclonal Antibody; NID1 (Nidogen 1; NID; NID-1; Nidogen-1; Entactin) (Biotin); anti-NID1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G3
Specificity
Recognizes human NID1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-NID1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1148-1248 from human NID1 (NP_002499) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EGLQYPFAVTSYGKNLYFTDWKMNSVVALDLAISKETDAFQPHKQTRLYGITTALSQCPQGHNYCSVNNGGCTHLCLATPGSRTCRCPDNTLGVDCIERK
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of NID1 expression in transfected 293T cell line by NID1 monoclonal antibody. Lane 1: NID1 transfected lysate (122.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NID1 expression in transfected 293T cell line by NID1 monoclonal antibody. Lane 1: NID1 transfected lysate (122.1kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged NID1 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NID1 is 1ng/ml as a capture antibody.)
Related Product Information for anti-NID1 antibody
Nidogen-1 is a member of the nidogen family of basement membrane glycoproteins. It interacts with several other components of basement membranes, and may play a role in cell interactions with the extracellular matrix.
Product Categories/Family for anti-NID1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
122,017 Da
NCBI Official Full Name
nidogen-1
NCBI Official Synonym Full Names
nidogen 1
NCBI Official Symbol
NID1
NCBI Official Synonym Symbols
NID
NCBI Protein Information
nidogen-1; NID-1; enactin; entactin
UniProt Protein Name
Nidogen-1
Protein Family
UniProt Gene Name
NID1
UniProt Synonym Gene Names
NID; NID-1
UniProt Entry Name
NID1_HUMAN

Uniprot Description

Nidogen-1: Sulfated glycoprotein widely distributed in basement membranes and tightly associated with laminin. Also binds to collagen IV and perlecan. It probably has a role in cell- extracellular matrix interactions. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 1q43

Cellular Component: extracellular matrix; extracellular region; basement membrane; basal lamina

Molecular Function: laminin-1 binding; collagen binding; proteoglycan binding; laminin binding; calcium ion binding

Biological Process: extracellular matrix disassembly; extracellular matrix organization and biogenesis; cell-matrix adhesion; glomerular basement membrane development

Similar Products

Product Notes

The NID1 nid1 (Catalog #AAA6143182) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NID1 (Nidogen 1, NID, NID-1, Nidogen-1, Entactin) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NID1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NID1 nid1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NID1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.