Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Mouse anti-Human NHLH2 Monoclonal Antibody | anti-NHLH2 antibody
NHLH2 (BHLHA34, HEN2, KIAA0490, Helix-loop-helix Protein 2, Class A Basic Helix-loop-helix Protein 34, Nescient Helix Loop Helix 2) (Biotin)
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NHLH2; Monoclonal Antibody; NHLH2 (BHLHA34; HEN2; KIAA0490; Helix-loop-helix Protein 2; Class A Basic Helix-loop-helix Protein 34; Nescient Helix Loop Helix 2) (Biotin); anti-NHLH2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4E4
Specificity
Recognizes human NHLH2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
135
Applicable Applications for anti-NHLH2 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Recombinant corresponding to aa36-135 from human NHLH2 (NP_005590) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to NHLH2 on HeLa cell. [antibody concentration 10ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to NHLH2 on HeLa cell. [antibody concentration 10ug/ml])
Testing Data
(Detection limit for recombinant GST tagged NHLH2 is ~0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged NHLH2 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-NHLH2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
helix-loop-helix protein 2
UniProt Protein Name
Helix-loop-helix protein 2
Protein Family
UniProt Gene Name
NHLH2
UniProt Synonym Gene Names
BHLHA34; HEN2; KIAA0490; HEN-2; bHLHa34; NSCL-2
UniProt Entry Name
HEN2_HUMAN
Uniprot Description
NHLH2: May serve as DNA-binding protein and may be involved in the control of cell-type determination, possibly within the developing nervous system.
Chromosomal Location of Human Ortholog: 1p12-p11
Cellular Component: transcription factor complex; nucleus
Molecular Function: protein dimerization activity; protein binding; DNA binding
Biological Process: central nervous system development; ovulation cycle; transcription, DNA-dependent; mating behavior; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription factor activity; cell differentiation
Similar Products
Product Notes
The NHLH2 nhlh2 (Catalog #AAA6143177) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NHLH2 (BHLHA34, HEN2, KIAA0490, Helix-loop-helix Protein 2, Class A Basic Helix-loop-helix Protein 34, Nescient Helix Loop Helix 2) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NHLH2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NHLH2 nhlh2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NHLH2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
