Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human NFX1 Monoclonal Antibody | anti-NFX1 antibody

NFX1 (Transcriptional Repressor NF-X1, Nuclear Transcription Factor, X Box-binding Protein 1, NFX2, DKFZp779G2416, MGC20369) (Biotin)

Gene Names
NFX1; NFX2; Tex42; TEG-42
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NFX1; Monoclonal Antibody; NFX1 (Transcriptional Repressor NF-X1; Nuclear Transcription Factor; X Box-binding Protein 1; NFX2; DKFZp779G2416; MGC20369) (Biotin); anti-NFX1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D12
Specificity
Recognizes human NFX1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-NFX1 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 30ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa981-1081 from human NFX1 (NP_002495) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KFSDSLKEDARKDLKFVSDVEKEMETLVEAVNKGKNSKKSHSFPPMNRDHRRIIHDLAQVYGLESVSYDSEPKRNVVVTAIRGKSVCPPTTLTGVLEREM
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(NFX1 monoclonal antibody. Western Blot analysis of NFX1 expression in HeLa NE)

Western Blot (WB) (NFX1 monoclonal antibody. Western Blot analysis of NFX1 expression in HeLa NE)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to NFX1 on HeLa cell. [antibody concentration 30ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to NFX1 on HeLa cell. [antibody concentration 30ug/ml])

Testing Data

(Detection limit for recombinant GST tagged NFX1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NFX1 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-NFX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
124kDa
NCBI Official Full Name
transcriptional repressor NF-X1 isoform 1
NCBI Official Synonym Full Names
nuclear transcription factor, X-box binding 1
NCBI Official Symbol
NFX1
NCBI Official Synonym Symbols
NFX2; Tex42; TEG-42
NCBI Protein Information
transcriptional repressor NF-X1
UniProt Protein Name
Transcriptional repressor NF-X1
UniProt Gene Name
NFX1
UniProt Synonym Gene Names
NFX2

NCBI Description

MHC class II gene expression is controlled primarily at the transcriptional level by transcription factors that bind to the X and Y boxes, two highly conserved elements in the proximal promoter of MHC class II genes. The protein encoded by this gene is a transcriptional repressor capable of binding to the conserved X box motif of HLA-DRA and other MHC class II genes in vitro. The protein may play a role in regulating the duration of an inflammatory response by limiting the period in which class II MHC molecules are induced by IFN-gamma. Three alternative splice variants, each of which encodes a different isoform, have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

NFX1: Binds to the X-box motif of MHC class II genes and represses their expression. May play an important role in regulating the duration of an inflammatory response by limiting the period in which MHC class II molecules are induced by interferon-gamma. Isoform 3 binds to the X-box motif of TERT promoter and represses its expression. Together with PABPC1 or PABPC4, isoform 1 acts as a coactivator for TERT expression. Mediates E2-dependent ubiquitination. Belongs to the NFX1 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 6.3.2.-; Ligase; Transcription factor; Ubiquitin conjugating system; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 9p13.3

Cellular Component: cytosol; nucleolus; nucleus; plasma membrane

Molecular Function: DNA binding transcription factor activity; ligase activity; RNA binding; zinc ion binding

Biological Process: inflammatory response; negative regulation of MHC class II biosynthetic process; negative regulation of transcription from RNA polymerase II promoter; transcription from RNA polymerase II promoter; viral process

Research Articles on NFX1

Similar Products

Product Notes

The NFX1 nfx1 (Catalog #AAA6143172) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NFX1 (Transcriptional Repressor NF-X1, Nuclear Transcription Factor, X Box-binding Protein 1, NFX2, DKFZp779G2416, MGC20369) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NFX1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 30ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NFX1 nfx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NFX1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.