Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human NFIX Monoclonal Antibody | anti-NFIX antibody

NFIX (Nuclear Factor 1 X-type, NF1-X, Nuclear Factor 1/X, CCAAT-box-binding Transcription Factor, CTF, Nuclear Factor I/X, NF-I/X, NFI-X, TGGCA-binding Protein) APC

Gene Names
NFIX; CTF; NF1A; NF1-X; MRSHSS; NF-I/X; SOTOS2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NFIX; Monoclonal Antibody; NFIX (Nuclear Factor 1 X-type; NF1-X; Nuclear Factor 1/X; CCAAT-box-binding Transcription Factor; CTF; Nuclear Factor I/X; NF-I/X; NFI-X; TGGCA-binding Protein) APC; anti-NFIX antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D2
Specificity
Recognizes human NFIX.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-NFIX antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa291-391 from human NFIX (NP_002492) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DDVFYPGTGRSPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGSSPRMAFTHHPLPVLAGVRPGSPRATASALHFPSTSIIQQSSPYFTHPTIR
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(NFIX monoclonal antibody. Western Blot analysis of NFIX expression in Jurkat.)

Western Blot (WB) (NFIX monoclonal antibody. Western Blot analysis of NFIX expression in Jurkat.)
Product Categories/Family for anti-NFIX antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
nuclear factor 1 X-type isoform 2
NCBI Official Synonym Full Names
nuclear factor I X
NCBI Official Symbol
NFIX
NCBI Official Synonym Symbols
CTF; NF1A; NF1-X; MRSHSS; NF-I/X; SOTOS2
NCBI Protein Information
nuclear factor 1 X-type
UniProt Protein Name
Nuclear factor 1 X-type
Protein Family
UniProt Gene Name
NFIX
UniProt Synonym Gene Names
NF1-X; Nuclear factor 1/X; CTF; NF-I/X; NFI-X
UniProt Entry Name
NFIX_HUMAN

NCBI Description

The protein encoded by this gene is a transcription factor that binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3 in viral and cellular promoters. The encoded protein can also stimulate adenovirus replication in vitro. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2012]

Research Articles on NFIX

Similar Products

Product Notes

The NFIX nfix (Catalog #AAA6137865) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NFIX (Nuclear Factor 1 X-type, NF1-X, Nuclear Factor 1/X, CCAAT-box-binding Transcription Factor, CTF, Nuclear Factor I/X, NF-I/X, NFI-X, TGGCA-binding Protein) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NFIX can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NFIX nfix for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NFIX, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.