Mouse anti-Human NFATC2 Monoclonal Antibody | anti-NFATC2 antibody

NFATC2 (Nuclear Factor Of Activated T-cells, Cytoplasmic 2, NF-ATc2, NFATc2, T-cell Transcription Factor NFAT1, NFAT Pre-existing Subunit, NF-ATp, NFAT1, NFATP) (HRP)

Cat. Num. AAA6153768

• Gene Names: NFATC2; NFAT1; NFATP
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NFATC2; Monoclonal Antibody; NFATC2 (Nuclear Factor Of Activated T-cells; Cytoplasmic 2; NF-ATc2; NFATc2; T-cell Transcription Factor NFAT1; NFAT Pre-existing Subunit; NF-ATp; NFAT1; NFATP) (HRP); anti-NFATC2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2A4
• Specificity: Recognizes human NFATC2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-NFATC2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa812-921 from human NFATC2 (NP_036472) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: HYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDELIDTHLSWIQNIL
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Testing Data

(Detection limit for recombinant GST tagged NFATC2 is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-NFATC2 antibody

NFATC2 is a member of the nuclear factor of activated T cells (NFAT) family. It is a DNA-binding protein with a REL-homology region (RHR) and an NFAT-homology region (NHR). This protein is present in the cytosol and only translocates to the nucleus upon T cell receptor (TCR) stimulation, where it becomes a member of the nuclear factors of activated T cells transcription complex. This complex plays a central role in inducing gene transcription during the immune response.

Product Categories/Family for anti-NFATC2 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 27886539
• NCBI GeneID: 4773
• NCBI Accession #: NP_036472
• NCBI GenBank Nucleotide #: NM_012340
• UniProt Accession #: Q13469; Q13468; Q5TFW7; Q5TFW8; Q9NPX6; Q9NQH3; Q9UJR2; B5B2N8; B5B2N9; B5B2P0; B5B2P2; B5B2P3
• Molecular Weight: 76,700 Da
• NCBI Official Full Name: nuclear factor of activated T-cells, cytoplasmic 2 isoform B
• NCBI Official Synonym Full Names: nuclear factor of activated T-cells 2
• NCBI Official Symbol: NFATC2
• NCBI Official Synonym Symbols: NFAT1; NFATP
• NCBI Protein Information: nuclear factor of activated T-cells, cytoplasmic 2
• UniProt Protein Name: Nuclear factor of activated T-cells, cytoplasmic 2
• Protein Family: NFATC2-interacting protein
• UniProt Gene Name: NFATC2
• UniProt Synonym Gene Names: NFAT1; NFATP; NF-ATc2; NFATc2; NF-ATp
• UniProt Entry Name: NFAC2_HUMAN

NCBI Description

This gene is a member of the nuclear factor of activated T cells (NFAT) family. The product of this gene is a DNA-binding protein with a REL-homology region (RHR) and an NFAT-homology region (NHR). This protein is present in the cytosol and only translocates to the nucleus upon T cell receptor (TCR) stimulation, where it becomes a member of the nuclear factors of activated T cells transcription complex. This complex plays a central role in inducing gene transcription during the immune response. Alternate transcriptional splice variants encoding different isoforms have been characterized. [provided by RefSeq, Apr 2012]

Uniprot Description

NFAT1: a transcription factor that plays a role in the inducible expression of cytokine genes in T cells, especially in the induction of the IL-2, IL-3, IL-4, TNF-alpha and GM-CSF. It is present in a phosphorylated the cytosol of unstimulated T cells. After T-cell activation, it is dephosphorylated by calcineurin and translocates to the nucleus as a part of a transcription complex. Two splice variant isoforms have been identified.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 20q13.2

Cellular Component: nucleoplasm; cytoplasm; plasma membrane; nucleus; cytosol; ribonucleoprotein complex; actin cytoskeleton

Molecular Function: protein binding; DNA binding; transcription factor activity

Biological Process: response to drug; B cell receptor signaling pathway; cell migration; transcription, DNA-dependent; regulation of transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; positive regulation of B cell proliferation; cytokine production; innate immune response; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter; response to DNA damage stimulus