Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human NFATC2 Monoclonal Antibody | anti-NFATC2 antibody

NFATC2 (Nuclear Factor Of Activated T-cells, Cytoplasmic 2, NF-ATc2, NFATc2, T-cell Transcription Factor NFAT1, NFAT Pre-existing Subunit, NF-ATp, NFAT1, NFATP) (HRP)

Gene Names
NFATC2; NFAT1; NFATP
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NFATC2; Monoclonal Antibody; NFATC2 (Nuclear Factor Of Activated T-cells; Cytoplasmic 2; NF-ATc2; NFATc2; T-cell Transcription Factor NFAT1; NFAT Pre-existing Subunit; NF-ATp; NFAT1; NFATP) (HRP); anti-NFATC2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2A4
Specificity
Recognizes human NFATC2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-NFATC2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa812-921 from human NFATC2 (NP_036472) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDELIDTHLSWIQNIL
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Testing Data

(Detection limit for recombinant GST tagged NFATC2 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NFATC2 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-NFATC2 antibody
NFATC2 is a member of the nuclear factor of activated T cells (NFAT) family. It is a DNA-binding protein with a REL-homology region (RHR) and an NFAT-homology region (NHR). This protein is present in the cytosol and only translocates to the nucleus upon T cell receptor (TCR) stimulation, where it becomes a member of the nuclear factors of activated T cells transcription complex. This complex plays a central role in inducing gene transcription during the immune response.
Product Categories/Family for anti-NFATC2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
76,700 Da
NCBI Official Full Name
nuclear factor of activated T-cells, cytoplasmic 2 isoform B
NCBI Official Synonym Full Names
nuclear factor of activated T-cells 2
NCBI Official Symbol
NFATC2
NCBI Official Synonym Symbols
NFAT1; NFATP
NCBI Protein Information
nuclear factor of activated T-cells, cytoplasmic 2
UniProt Protein Name
Nuclear factor of activated T-cells, cytoplasmic 2
UniProt Gene Name
NFATC2
UniProt Synonym Gene Names
NFAT1; NFATP; NF-ATc2; NFATc2; NF-ATp
UniProt Entry Name
NFAC2_HUMAN

NCBI Description

This gene is a member of the nuclear factor of activated T cells (NFAT) family. The product of this gene is a DNA-binding protein with a REL-homology region (RHR) and an NFAT-homology region (NHR). This protein is present in the cytosol and only translocates to the nucleus upon T cell receptor (TCR) stimulation, where it becomes a member of the nuclear factors of activated T cells transcription complex. This complex plays a central role in inducing gene transcription during the immune response. Alternate transcriptional splice variants encoding different isoforms have been characterized. [provided by RefSeq, Apr 2012]

Uniprot Description

NFAT1: a transcription factor that plays a role in the inducible expression of cytokine genes in T cells, especially in the induction of the IL-2, IL-3, IL-4, TNF-alpha and GM-CSF. It is present in a phosphorylated the cytosol of unstimulated T cells. After T-cell activation, it is dephosphorylated by calcineurin and translocates to the nucleus as a part of a transcription complex. Two splice variant isoforms have been identified.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 20q13.2

Cellular Component: nucleoplasm; cytoplasm; plasma membrane; nucleus; cytosol; ribonucleoprotein complex; actin cytoskeleton

Molecular Function: protein binding; DNA binding; transcription factor activity

Biological Process: response to drug; B cell receptor signaling pathway; cell migration; transcription, DNA-dependent; regulation of transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; positive regulation of B cell proliferation; cytokine production; innate immune response; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter; response to DNA damage stimulus

Research Articles on NFATC2

Similar Products

Product Notes

The NFATC2 nfatc2 (Catalog #AAA6153768) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NFATC2 (Nuclear Factor Of Activated T-cells, Cytoplasmic 2, NF-ATc2, NFATc2, T-cell Transcription Factor NFAT1, NFAT Pre-existing Subunit, NF-ATp, NFAT1, NFATP) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NFATC2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NFATC2 nfatc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NFATC2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.