Rabbit Emerin Polyclonal Antibody | anti-EMD antibody

Anti-Emerin Antibody

Cat. Num. AAA178620

• Gene Names: EMD; STA; EDMD; LEMD5
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen affinity purified.
• Synonyms: Emerin; Polyclonal Antibody; Anti-Emerin Antibody; EDMD; Emd; LEMD5; STA; P50402; anti-EMD antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Immunogen affinity purified.
• Form/Format: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 254

• Applicable Applications for anti-EMD antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot: 0.1-0.5ug/ml; Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml
• Notes: Tested Species: In-house tested species with positive results.; By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.; Other applications have not been tested.
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Emerin (1-48aa MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRL), different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino acids.
• Preparation and Storage: Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of Emerin expression in rat skeletal muscle extract (lane 1), mouse cardiac muscle extract (lane 2) and HELA whole cell lysates (lane 3). Emerin at 34KD was detected using rabbit anti- Emerin Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Immunohistochemistry (IHC)

(Emerin was detected in paraffin-embedded sections of human intetsinal cancer tissues using rabbit anti- Emerin Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(Emerin was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- Emerin Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Related Product Information for anti-EMD antibody

Rabbit IgG polyclonal antibody for Emerin(EMD) detection.
Background: Emerin is a serine-rich nuclear membrane protein that in humans is encoded by the EMD gene. And this gene is mapped to Xq28. Emerin is a member of the nuclear lamina-associated protein family. It mediates membrane anchorage to the cytoskeleton. Emery-Dreifuss muscular dystrophy is an X-linked inherited degenerative myopathy resulting from mutation in the EMD (also known clinically as STA) gene. Emerin appears to be involved in mechanotransduction, as emerin-deficient mouse fibroblasts failed to transduce normal mechanosensitive gene expression responses to strain stimuli. In cardiac muscle, emerin is also found complexed to beta-catenin at adherens junctions of intercalated discs, and cardiomyocytes from hearts lacking emerin showed beta-catenin redistribution as well as perturbed intercalated disc architecture and myocyte shape. This interaction appears to be regulated by glycogen synthase kinase 3 beta.

References

1. "Entrez Gene: EMD emerin (Emery-Dreifuss muscular dystrophy)".
2. Lammerding, J; Hsiao, J; Schulze, PC; Kozlov, S; Stewart, CL; Lee, RT (29 August 2005). "Abnormal nuclear shape and impaired mechanotransduction in emerin-deficient cells.". The Journal of Cell Biology. 170 (5): 781-91.
3. Nagano A, Koga R, Ogawa M, Kurano Y, Kawada J, Okada R, Hayashi YK, Tsukahara T, Arahata K (Mar 1996). "Emerin deficiency at the nuclear membrane in patients with Emery-Dreifuss muscular dystrophy". Nature Genetics. 12 (3): 254-9.

NCBI and Uniprot Product Information

• NCBI GI #: 4557553
• NCBI GeneID: 2010
• NCBI Accession #: NP_000108.1
• NCBI GenBank Nucleotide #: NM_000117.2
• UniProt Accession #: P50402; Q6FI02
• Molecular Weight: 28,994 Da
• NCBI Official Full Name: emerin
• NCBI Official Synonym Full Names: emerin
• NCBI Official Symbol: EMD
• NCBI Official Synonym Symbols: STA; EDMD; LEMD5
• NCBI Protein Information: emerin
• UniProt Protein Name: Emerin
• Protein Family: Emerin
• UniProt Gene Name: EMD
• UniProt Synonym Gene Names: EDMD; STA

NCBI Description

Emerin is a serine-rich nuclear membrane protein and a member of the nuclear lamina-associated protein family. It mediates membrane anchorage to the cytoskeleton. Dreifuss-Emery muscular dystrophy is an X-linked inherited degenerative myopathy resulting from mutation in the emerin gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Stabilizes and promotes the formation of a nuclear actin cortical network. Stimulates actin polymerization in vitro by binding and stabilizing the pointed end of growing filaments. Inhibits beta-catenin activity by preventing its accumulation in the nucleus. Acts by influencing the nuclear accumulation of beta-catenin through a CRM1-dependent export pathway. Links centrosomes to the nuclear envelope via a microtubule association. EMD and BAF are cooperative cofactors of HIV-1 infection. Association of EMD with the viral DNA requires the presence of BAF and viral integrase. The association of viral DNA with chromatin requires the presence of BAF and EMD. Required for proper localization of non-farnesylated prelamin-A/C.