Mouse anti-Human Neurofibromin Monoclonal Antibody | anti-NF antibody

Neurofibromin (NF1, WSS, NFNS, VRNF, NF, Neurofibromin 1, Neurofibromatosis, Type I, von Recklinghausen Disease Neurofibromin, Neurofibromatosis-Noonan Syndrome, WATS, Watson Syndrome) (HRP)

Cat. Num. AAA6153764

• Gene Names: NF1; WSS; NFNS; VRNF
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Neurofibromin; Monoclonal Antibody; Neurofibromin (NF1; WSS; NFNS; VRNF; NF; Neurofibromin 1; Neurofibromatosis; Type I; von Recklinghausen Disease Neurofibromin; Neurofibromatosis-Noonan Syndrome; WATS; Watson Syndrome) (HRP); anti-NF antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Clone Number: 2D1
• Specificity: Recognizes human NF1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 2818

• Applicable Applications for anti-NF antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa2719-2818 from human NF1 (NP_000258) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DTYLPGIDEETSEESLLTPTSPYPPALQSQLSITANLNLSNSMTSLATSQHSPGIDKENVELSPTTGHCNSGRTRHGSASQVQKQRSAGSFKRNSIKKIV
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged NF1 is ~3ng/ml as a capture antibody.)

Related Product Information for anti-NF antibody

NF1 contains a GTPase-activating protein-related domain (GRD), and is involved in the negative regulation of Ras proteins, by accelerating the hydrolysis of active Ras-guanosine triphosphate. Mutations of NF1 have been reported in Neurofibromatosis type 1, which is characterized by a predisposition to a variety of tumors of the peripheral and central nervous systems as well as myeloid leukemia, cognitive deficits, bone deformations, and pigmentation defects.

Product Categories/Family for anti-NF antibody

Antibodies; Cancer Markers

NCBI and Uniprot Product Information

• NCBI GI #: 4557793
• NCBI GeneID: 4763
• NCBI Accession #: NP_000258
• NCBI GenBank Nucleotide #: NM_000267
• UniProt Accession #: P21359
• NCBI Official Full Name: neurofibromin isoform 2
• NCBI Official Synonym Full Names: neurofibromin 1
• NCBI Official Symbol: NF1
• NCBI Official Synonym Symbols: WSS; NFNS; VRNF
• NCBI Protein Information: neurofibromin
• UniProt Protein Name: Neurofibromin
• Protein Family: Neurofibromin
• UniProt Gene Name: NF1
• UniProt Entry Name: NF1_HUMAN

NCBI Description

This gene product appears to function as a negative regulator of the ras signal transduction pathway. Mutations in this gene have been linked to neurofibromatosis type 1, juvenile myelomonocytic leukemia and Watson syndrome. The mRNA for this gene is subject to RNA editing (CGA>UGA->Arg1306Term) resulting in premature translation termination. Alternatively spliced transcript variants encoding different isoforms have also been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

NF1: a Ras-GAP, highly expressed in developing neural cells. Possesses tumor suppressor activity, presumably by virtue of its GTPase activating domain. Neurofibromin is phosphorylated in response to EGF in CNS cells and cell lines. Defects in NF1 are the cause of type 1 neurofibromatosis (NF1), Watson syndrome, and familial spinal neurofibromatosis. NF1 is one of the most frequent autosomal dominant diseases. Four alternatively spliced isoforms have been described.

Protein type: Tumor suppressor; GAPs, Ras; GAPs; Nucleolus; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: membrane; axon; dendrite; cytoplasm; nucleolus; nucleus

Molecular Function: protein binding; phosphatidylethanolamine binding; phosphatidylcholine binding

Biological Process: negative regulation of Rac protein signal transduction; neural tube development; negative regulation of MAP kinase activity; Schwann cell development; extracellular matrix organization and biogenesis; collagen fibril organization; positive regulation of apoptosis; heart development; negative regulation of transcription factor import into nucleus; negative regulation of neuroblast proliferation; regulation of glial cell differentiation; positive regulation of adenylate cyclase activity; negative regulation of neurotransmitter secretion; skeletal muscle development; adrenal gland development; forebrain morphogenesis; negative regulation of cell-matrix adhesion; regulation of synaptic transmission, GABAergic; myelination in the peripheral nervous system; camera-type eye morphogenesis; induction of apoptosis via death domain receptors; negative regulation of fibroblast proliferation; negative regulation of endothelial cell proliferation; negative regulation of protein kinase activity; positive regulation of endothelial cell proliferation; cerebral cortex development; actin cytoskeleton organization and biogenesis; forebrain astrocyte development; metanephros development; regulation of long-term neuronal synaptic plasticity; negative regulation of osteoclast differentiation; phosphoinositide 3-kinase cascade; wound healing; regulation of cell-matrix adhesion; regulation of blood vessel endothelial cell migration; smooth muscle development; sympathetic nervous system development; positive regulation of neuron apoptosis; visual learning; negative regulation of Ras protein signal transduction; cell communication; negative regulation of cell migration; regulation of bone resorption; negative regulation of MAPKKK cascade; MAPKKK cascade; liver development; regulation of angiogenesis; peripheral nervous system development; osteoblast differentiation; negative regulation of oligodendrocyte differentiation; negative regulation of angiogenesis; pigmentation; spinal cord development; negative regulation of astrocyte differentiation; Ras protein signal transduction; response to hypoxia; artery morphogenesis; brain development; cognition

Disease: Neurofibromatosis, Familial Spinal; Watson Syndrome; Juvenile Myelomonocytic Leukemia; Neurofibromatosis, Type I; Neurofibromatosis-noonan Syndrome