Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human NEUROD6 Monoclonal Antibody | anti-Neurod6 antibody

NEUROD6 (Neurogenic Differentiation Factor 6, NeuroD6, Class A Basic Helix-loop-helix Protein 2, bHLHa2, Protein Atonal Homolog 2, ATOH2, BHLHA2, My051, MATH2, NEX1M)

Gene Names
Neurod6; RGD1562793
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
NEUROD6; Monoclonal Antibody; NEUROD6 (Neurogenic Differentiation Factor 6; NeuroD6; Class A Basic Helix-loop-helix Protein 2; bHLHa2; Protein Atonal Homolog 2; ATOH2; BHLHA2; My051; MATH2; NEX1M); Anti -NEUROD6 (Neurogenic Differentiation Factor 6; anti-Neurod6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B3
Specificity
Recognizes human NEUROD6.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
GQGGEAAHHTRSPYSTFYPPYHSPELTTPPGHGTLDNSKSMKPYNYCSAYESFYESTSPECASPQFEGPLSPPPINYNGIFSLKQEETLDYGKNYNYGMH
Applicable Applications for anti-Neurod6 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Full length recombinant corresponding to aa191-290 from human NEUROD6 (NP_073565) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Testing Data

(Detection limit for recombinant GST tagged NEUROD6 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NEUROD6 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-Neurod6 antibody
NEUROD6 is a member of the NEUROD (NEUROD1; MIM 601724) family of basic helix-loop-helix (bHLH) transcription factors (Guo et al., 2002 [PubMed 12357074]).
Product Categories/Family for anti-Neurod6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
neuronal differentiation 6
NCBI Official Synonym Full Names
neuronal differentiation 6
NCBI Official Symbol
Neurod6
NCBI Official Synonym Symbols
RGD1562793
NCBI Protein Information
neuronal differentiation 6; neurogenic differentiation 6

Research Articles on Neurod6

Similar Products

Product Notes

The Neurod6 (Catalog #AAA6004247) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NEUROD6 (Neurogenic Differentiation Factor 6, NeuroD6, Class A Basic Helix-loop-helix Protein 2, bHLHa2, Protein Atonal Homolog 2, ATOH2, BHLHA2, My051, MATH2, NEX1M) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NEUROD6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the Neurod6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GQGGEAAHHT RSPYSTFYPP YHSPELTTPP GHGTLDNSKS MKPYNYCSAY ESFYESTSPE CASPQFEGPL SPPPINYNGI FSLKQEETLD YGKNYNYGMH. It is sometimes possible for the material contained within the vial of "NEUROD6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.