Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.53kD).)

Mouse anti-Human NEU2 Monoclonal Antibody | anti-NEU2 antibody

NEU2 (Sialidase-2, Cytosolic Sialidase, N-acetyl-alpha-neuraminidase 2) (Biotin)

Gene Names
NEU2; SIAL2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NEU2; Monoclonal Antibody; NEU2 (Sialidase-2; Cytosolic Sialidase; N-acetyl-alpha-neuraminidase 2) (Biotin); anti-NEU2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B9
Specificity
Recognizes human NEU2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-NEU2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa180-268 from human NEU2 (NP_005374) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AYRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPP
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.53kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.53kD).)

Western Blot (WB)

(NEU2 monoclonal antibody Western Blot analysis of NEU2 expression in human liver.)

Western Blot (WB) (NEU2 monoclonal antibody Western Blot analysis of NEU2 expression in human liver.)

Western Blot (WB)

(NEU2 monoclonal antibody Western Blot analysis of NEU2 expression in human fetal liver.)

Western Blot (WB) (NEU2 monoclonal antibody Western Blot analysis of NEU2 expression in human fetal liver.)
Product Categories/Family for anti-NEU2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,254 Da
NCBI Official Full Name
sialidase-2
NCBI Official Synonym Full Names
sialidase 2 (cytosolic sialidase)
NCBI Official Symbol
NEU2
NCBI Official Synonym Symbols
SIAL2
NCBI Protein Information
sialidase-2
UniProt Protein Name
Sialidase-2
Protein Family
UniProt Gene Name
NEU2

NCBI Description

This gene belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. Expression studies in COS7 cells confirmed that this gene encodes a functional sialidase. Its cytosolic localization was demonstrated by cell fractionation experiments. [provided by RefSeq, Jul 2008]

Uniprot Description

Catalyzes the removal of sialic acid (N-acetylneuraminic acid) moities from glycoproteins, oligosaccharides and gangliosides.

Research Articles on NEU2

Similar Products

Product Notes

The NEU2 neu2 (Catalog #AAA6143153) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NEU2 (Sialidase-2, Cytosolic Sialidase, N-acetyl-alpha-neuraminidase 2) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NEU2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NEU2 neu2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NEU2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.