Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged NEU1 is 0.03 ng/ml as a capture antibody.)

Mouse NEU1 Monoclonal Antibody | anti-NEU1 antibody

NEU1 (Sialidase 1 (Lysosomal Sialidase), FLJ93471, NANH, NEU, SIAL1) (APC)

Gene Names
NEU1; NEU; NANH; SIAL1
Applications
Western Blot
Purity
Purified
Synonyms
NEU1; Monoclonal Antibody; NEU1 (Sialidase 1 (Lysosomal Sialidase); FLJ93471; NANH; NEU; SIAL1) (APC); Sialidase 1 (Lysosomal Sialidase); SIAL1; anti-NEU1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F9
Specificity
Recognizes NEU1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-NEU1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NEU1 (NP_000425, 334aa-415aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged NEU1 is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NEU1 is 0.03 ng/ml as a capture antibody.)

Western Blot (WB)

(NEU1 monoclonal antibody (M01), clone 3F9. Western Blot analysis of NEU1 expression in Raw 264.7.)

Western Blot (WB) (NEU1 monoclonal antibody (M01), clone 3F9. Western Blot analysis of NEU1 expression in Raw 264.7.)

Western Blot (WB)

(NEU1 monoclonal antibody (M01), clone 3F9. Western Blot analysis of NEU1 expression in PC-12.)

Western Blot (WB) (NEU1 monoclonal antibody (M01), clone 3F9. Western Blot analysis of NEU1 expression in PC-12.)

Western Blot (WB)

(NEU1 monoclonal antibody (M01), clone 3F9. Western Blot analysis of NEU1 expression in IMR-32.)

Western Blot (WB) (NEU1 monoclonal antibody (M01), clone 3F9. Western Blot analysis of NEU1 expression in IMR-32.)
Related Product Information for anti-NEU1 antibody
Mouse monoclonal antibody raised against a partial recombinant NEU1.
Product Categories/Family for anti-NEU1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42.9 kDa (393aa), confirmed by MALDI-TOF
NCBI Official Full Name
sialidase-1
NCBI Official Synonym Full Names
neuraminidase 1
NCBI Official Symbol
NEU1
NCBI Official Synonym Symbols
NEU; NANH; SIAL1
NCBI Protein Information
sialidase-1
UniProt Protein Name
Sialidase-1
Protein Family
UniProt Gene Name
NEU1
UniProt Synonym Gene Names
NANH
UniProt Entry Name
NEUR1_HUMAN

NCBI Description

The protein encoded by this gene is a lysosomal enzyme that cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A (the latter is also referred to as 'protective protein'). Mutations in this gene can lead to sialidosis, a lysosomal storage disease that can be type 1 (cherry red spot-myoclonus syndrome or normosomatic type), which is late-onset, or type 2 (the dysmorphic type), which occurs at an earlier age with increased severity. [provided by RefSeq, Jul 2008]

Uniprot Description

NEU1: Catalyzes the removal of sialic acid (N-acetylneuramic acid) moities from glycoproteins and glycolipids. To be active, it is strictly dependent on its presence in the multienzyme complex. Appears to have a preference for alpha 2-3 and alpha 2-6 sialyl linkage. Defects in NEU1 are the cause of sialidosis (SIALIDOSIS). It is a lysosomal storage disease occurring as two types with various manifestations. Type 1 sialidosis (cherry red spot-myoclonus syndrome or normosomatic type) is late-onset and it is characterized by the formation of cherry red macular spots in childhood, progressive debilitating myoclonus, insiduous visual loss and rarely ataxia. The diagnosis can be confirmed by the screening of the urine for sialyloligosaccharides. Type 2 sialidosis (also known as dysmorphic type) occurs as several variants of increasing severity with earlier age of onset. It is characterized by the presence of abnormal somatic features including coarse facies and dysostosis multiplex, vertebral deformities, mental retardation, cherry-red spot/myoclonus, sialuria, cytoplasmic vacuolation of peripheral lymphocytes, bone marrow cells and conjunctival epithelial cells. Belongs to the glycosyl hydrolase 33 family.

Protein type: EC 3.2.1.18; Motility/polarity/chemotaxis; Glycan Metabolism - other glycan degradation; Hydrolase; Lipid Metabolism - sphingolipid

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: lysosomal lumen; intracellular membrane-bound organelle; lysosome; lysosomal membrane; cytoplasmic membrane-bound vesicle; plasma membrane; cell junction

Molecular Function: exo-alpha-sialidase activity

Biological Process: oligosaccharide catabolic process; cellular protein metabolic process; sphingolipid metabolic process; dolichol-linked oligosaccharide biosynthetic process; protein amino acid N-linked glycosylation via asparagine; glycosphingolipid metabolic process; post-translational protein modification; lipid catabolic process

Disease: Neuraminidase Deficiency

Research Articles on NEU1

Similar Products

Product Notes

The NEU1 neu1 (Catalog #AAA6170246) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NEU1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NEU1 neu1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NEU1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.