Testing Data
(Detection limit for recombinant GST tagged NELL2 is 0.3 ng/ml as a capture antibody.)
Mouse NELL2 Monoclonal Antibody | anti-NELL2 antibody
NELL2 (NEL-like 2 (chicken), NRP2) (Biotin)
Applications
ELISA
Purity
Purified
Synonyms
NELL2; Monoclonal Antibody; NELL2 (NEL-like 2 (chicken); NRP2) (Biotin); NEL-like 2 (chicken); NRP2; anti-NELL2 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2D11
Specificity
Recognizes NELL2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
816
Applicable Applications for anti-NELL2 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NELL2 (NP_006150.1, 301aa-400aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IQCETLICPNPDCPLKSALAYVDGKCCKECKSICQFQGRTYFEGERNTVYSSSGVCVLYECKDQTMKLVESSGCPALDCPESHQITLSHSCCKVCKGYDF
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged NELL2 is 0.3 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged NELL2 is 0.3 ng/ml as a capture antibody.)
Related Product Information for anti-NELL2 antibody
The protein encoded by this gene is a glycoprotein containing several von Willebrand factor C domains and epidermal growth factor (EGF)-like domains. The encoded protein acts as a homotrimer and is found in the cytoplasm. Several variants encoding a few different isoforms exist, and at least one isoform appears to be a secreted protein. Studies in mouse suggest that this protein plays a role in neural cell growth and differentiation as well as in oncogenesis. [provided by RefSeq]
Product Categories/Family for anti-NELL2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
protein kinase C-binding protein NELL2 isoform b
UniProt Protein Name
Protein kinase C-binding protein NELL2
Protein Family
UniProt Gene Name
NELL2
UniProt Synonym Gene Names
NRP2
Uniprot Description
Required for neuron survival through the modulation of MAPK pathways (). Involved in the regulation of hypothalamic GNRH secretion and the control of puberty ().
Similar Products
Product Notes
The NELL2 nell2 (Catalog #AAA6173573) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NELL2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NELL2 nell2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NELL2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
