Mouse anti-Human NELL1 Monoclonal Antibody | anti-NELL1 antibody

NELL1 (Protein Kinase C-binding Protein NELL1, NEL-like Protein 1, Nel-related Protein 1, NRP1) (HRP)

Cat. Num. AAA6153755

• Gene Names: NELL1; NRP1; IDH3GL
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NELL1; Monoclonal Antibody; NELL1 (Protein Kinase C-binding Protein NELL1; NEL-like Protein 1; Nel-related Protein 1; NRP1) (HRP); anti-NELL1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6A8
• Specificity: Recognizes human NELL1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-NELL1 antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa304-403 from human NELL1 (NP_006148) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: CRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILTKSCRECRGGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGE
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of NELL1 expression in transfected 293T cell line by NELL1 monoclonal antibody Lane 1: NELL1 transfected lysate (89.607kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to NELL1 on HeLa cell. [antibody concentration 10ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of NELL1 transfected lysate using NELL1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NELL1 rabbit polyclonal antibody.)

Related Product Information for anti-NELL1 antibody

NELL1 (neural EGF-like like protein 1) is an 89kD (predicted) member of the EGF-like domain containing family, Laminin G/NTSP1/Pentraxin gene superfamily of molecules. When secreted, NELL1 exists as a phosphoglycoprotein that can add as much as 50kD to the calculated MW. NELL1 has restricted expression, being limited to pre-B cells and osteoblasts, where it apparently promotes osteoblast maturation and bone formation. In tumors, it is found in neuroblastoma- derived cells. NELL1 is both secreted and retained intracellularly where it is phosphorylated by PKC. The human NELL1 precursor is 810aa in length. It contains a16aa signal sequence plus a 794aa mature region. The mature region possesses an N-terminal TSP domain (aa81-230), two VWFC domains (aa271-390), six consecutive EGF-like domains (aa391-631), and three additional C-terminal VWFC domains (aa632 807). Secreted NELL1 forms a 400-420kD noncovalent homotrimer. Over aa17-810, human NELL1 shares 93% aa identity with mouse and rat NELL1. Alternate splicing generates an additional isoform of human NELL1 hat lacks the fifth EGF-like domain.

Product Categories/Family for anti-NELL1 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 222352164
• NCBI GeneID: 4745
• NCBI Accession #: NP_006148
• NCBI GenBank Nucleotide #: NM_006157
• UniProt Accession #: Q92832; Q4VB90; Q4VB91; Q6NSY8; Q9Y472; B2CKC1
• Molecular Weight: 84,377 Da
• NCBI Official Full Name: protein kinase C-binding protein NELL1 isoform 1
• NCBI Official Synonym Full Names: NEL-like 1 (chicken)
• NCBI Official Symbol: NELL1
• NCBI Official Synonym Symbols: NRP1; IDH3GL
• NCBI Protein Information: protein kinase C-binding protein NELL1; nel-related protein 1; neural epidermal growth factor-like 1
• UniProt Protein Name: Protein kinase C-binding protein NELL1
• Protein Family: Protein kinase C-binding protein
• UniProt Gene Name: NELL1
• UniProt Synonym Gene Names: NRP1
• UniProt Entry Name: NELL1_HUMAN