Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human, Mouse NEDD1 Monoclonal Antibody | anti-NEDD1 antibody

NEDD1 (Protein NEDD1, Neural Precursor Cell Expressed Developmentally Down-Regulated Protein 1, NEDD-1, FLJ35902, GCP-WD, TUBGCP7) (HRP)

Gene Names
NEDD1; GCP-WD; TUBGCP7
Reactivity
Human, Mouse
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NEDD1; Monoclonal Antibody; NEDD1 (Protein NEDD1; Neural Precursor Cell Expressed Developmentally Down-Regulated Protein 1; NEDD-1; FLJ35902; GCP-WD; TUBGCP7) (HRP); anti-NEDD1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
7D10
Specificity
Recognizes human NEDD1. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-NEDD1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 0.75ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa561-661 from human NEDD1 (NP_690869) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AGVASSLSEKIADSIGNNRQNAPLTSIQIRFIQNMIQETLDDFREACHRDIVNLQVEMIKQFHMQLNEMHSLLERYSVNEGLVAEIERLREENKRLRAHF
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(NEDD1 monoclonal antibody, Western Blot analysis of NEDD1 expression in Hela NE.)

Western Blot (WB) (NEDD1 monoclonal antibody, Western Blot analysis of NEDD1 expression in Hela NE.)

Western Blot (WB)

(NEDD1 monoclonal antibody. Western Blot analysis of NEDD1 expression in NIH/3T3.)

Western Blot (WB) (NEDD1 monoclonal antibody. Western Blot analysis of NEDD1 expression in NIH/3T3.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to NEDD1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 0.75ug/ml.)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to NEDD1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 0.75ug/ml.)

Testing Data

(Detection limit for recombinant GST tagged NEDD1 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NEDD1 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-NEDD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72kDa
NCBI Official Full Name
protein NEDD1 isoform b
NCBI Official Synonym Full Names
neural precursor cell expressed, developmentally down-regulated 1
NCBI Official Symbol
NEDD1
NCBI Official Synonym Symbols
GCP-WD; TUBGCP7
NCBI Protein Information
protein NEDD1
UniProt Protein Name
Protein NEDD1
Protein Family
UniProt Gene Name
NEDD1
UniProt Synonym Gene Names
NEDD-1
UniProt Entry Name
NEDD1_HUMAN

Uniprot Description

NEDD1: Required for mitosis progression. Promotes the nucleation of microtubules from the spindle. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation

Chromosomal Location of Human Ortholog: 12q23.1

Cellular Component: centriole; nucleoplasm; spindle pole; centrosome; pericentriolar material; apical part of cell; nucleolus; plasma membrane; cytosol

Biological Process: mitosis; cell division; organelle organization and biogenesis; mitotic cell cycle; G2/M transition of mitotic cell cycle

Research Articles on NEDD1

Similar Products

Product Notes

The NEDD1 nedd1 (Catalog #AAA6153742) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NEDD1 (Protein NEDD1, Neural Precursor Cell Expressed Developmentally Down-Regulated Protein 1, NEDD-1, FLJ35902, GCP-WD, TUBGCP7) (HRP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's NEDD1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 0.75ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NEDD1 nedd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NEDD1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.