Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (NDUFS4 monoclonal antibody (M03), clone 3F11. Western Blot analysis of NDUFS4 expression in human kidney.)

Mouse NDUFS4 Monoclonal Antibody | anti-NDUFS4 antibody

NDUFS4 (NADH Dehydrogenase (ubiquinone) Fe-S Protein 4, 18kD (NADH-Coenzyme Q Reductase), AQDQ) (AP)

Gene Names
NDUFS4; AQDQ; CI-18; CI-AQDQ; CI-18 kDa
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
NDUFS4; Monoclonal Antibody; NDUFS4 (NADH Dehydrogenase (ubiquinone) Fe-S Protein 4; 18kD (NADH-Coenzyme Q Reductase); AQDQ) (AP); NADH Dehydrogenase (ubiquinone) Fe-S Protein 4; AQDQ; anti-NDUFS4 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F11
Specificity
Recognizes NDUFS4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-NDUFS4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NDUFS4 (NP_002486, 66aa-175aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(NDUFS4 monoclonal antibody (M03), clone 3F11. Western Blot analysis of NDUFS4 expression in human kidney.)

Western Blot (WB) (NDUFS4 monoclonal antibody (M03), clone 3F11. Western Blot analysis of NDUFS4 expression in human kidney.)
Product Categories/Family for anti-NDUFS4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15.5 kDa (134aa), confirmed by MALDI-TOF.
NCBI Official Full Name
NADH dehydrogenase
NCBI Official Synonym Full Names
NADH:ubiquinone oxidoreductase subunit S4
NCBI Official Symbol
NDUFS4
NCBI Official Synonym Symbols
AQDQ; CI-18; CI-AQDQ; CI-18 kDa
NCBI Protein Information
NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
UniProt Protein Name
NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
UniProt Gene Name
NDUFS4
UniProt Synonym Gene Names
CI-18 kDa; CI-AQDQ
UniProt Entry Name
NDUS4_HUMAN

NCBI Description

This gene encodes an nuclear-encoded accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (complex I, or NADH:ubiquinone oxidoreductase). Complex I removes electrons from NADH and passes them to the electron acceptor ubiquinone. Mutations in this gene can cause mitochondrial complex I deficiencies such as Leigh syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]

Uniprot Description

NDUFS4: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Defects in NDUFS4 are a cause of mitochondrial complex I deficiency (MT-C1D). A disorder of the mitochondrial respiratory chain that causes a wide range of clinical disorders, from lethal neonatal disease to adult-onset neurodegenerative disorders. Phenotypes include macrocephaly with progressive leukodystrophy, non-specific encephalopathy, cardiomyopathy, myopathy, liver disease, Leigh syndrome, Leber hereditary optic neuropathy, and some forms of Parkinson disease. Belongs to the complex I NDUFS4 subunit family.

Protein type: EC 1.6.99.3; Oxidoreductase; Energy Metabolism - oxidative phosphorylation; Mitochondrial; EC 1.6.5.3

Chromosomal Location of Human Ortholog: 5q11.1

Cellular Component: mitochondrion; mitochondrial inner membrane; mitochondrial respiratory chain complex I

Molecular Function: NADH dehydrogenase (ubiquinone) activity

Biological Process: cellular metabolic process; mitochondrial respiratory chain complex I assembly; positive regulation of fibroblast proliferation; cAMP-mediated signaling; regulation of protein amino acid phosphorylation; response to cAMP; mitochondrial electron transport, NADH to ubiquinone; cellular respiration; brain development

Disease: Leigh Syndrome; Mitochondrial Complex I Deficiency

Research Articles on NDUFS4

Similar Products

Product Notes

The NDUFS4 ndufs4 (Catalog #AAA6163754) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NDUFS4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NDUFS4 ndufs4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NDUFS4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.