Mouse anti-Human NDUFB5 Monoclonal Antibody | anti-NDUFB5 antibody

NDUFB5 (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 5, Mitochondrial, Complex I-SGDH, NADH-ubiquinone Oxidoreductase SGDH Subunit, DKFZp686N02262, FLJ30597, MGC111204, MGC12314) (Biotin)

Cat. Num. AAA6143127

• Gene Names: NDUFB5; SGDH; CISGDH
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NDUFB5; Monoclonal Antibody; NDUFB5 (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 5; Mitochondrial; Complex I-SGDH; NADH-ubiquinone Oxidoreductase SGDH Subunit; DKFZp686N02262; FLJ30597; MGC111204; MGC12314) (Biotin); anti-NDUFB5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5G5
• Specificity: Recognizes human NDUFB5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-NDUFB5 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa95-189 from human NDUFB5 (NP_002483) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QAELAEIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.19kD).)

Western Blot (WB)

(Western Blot analysis of NDUFB5 expression in transfected 293T cell line by NDUFB5 monoclonal antibody. Lane 1: NDUFB5 transfected lysate (21.8kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-NDUFB5 antibody

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Product Categories/Family for anti-NDUFB5 antibody

Antibodies; Enzymes; Dehydrogenase

NCBI and Uniprot Product Information

• NCBI GI #: 4505363
• NCBI GeneID: 4711
• NCBI Accession #: NP_002483
• NCBI GenBank Nucleotide #: NM_002492
• UniProt Accession #: O43674
• Molecular Weight: 17kDa
• NCBI Official Full Name: NADH dehydrogenase
• NCBI Official Synonym Full Names: NADH:ubiquinone oxidoreductase subunit B5
• NCBI Official Symbol: NDUFB5
• NCBI Official Synonym Symbols: SGDH; CISGDH
• NCBI Protein Information: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
• UniProt Protein Name: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
• Protein Family: NADH dehydrogenase
• UniProt Gene Name: NDUFB5
• UniProt Synonym Gene Names: CI-SGDH
• UniProt Entry Name: NDUB5_HUMAN

NCBI Description

The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2011]