Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.78kD).)

Mouse anti-Human NDC80 Monoclonal Antibody | anti-NDC80 antibody

NDC80 (Kinetochore Protein NDC80 Homolog, Highly Expressed in Cancer Protein, Kinetochore Protein Hec1, HsHec1, Kinetochore-associated Protein 2, Retinoblastoma-associated Protein HEC, HEC, HEC1, KNTC2) APC

Gene Names
NDC80; HEC; HEC1; TID3; KNTC2; HsHec1; hsNDC80
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NDC80; Monoclonal Antibody; NDC80 (Kinetochore Protein NDC80 Homolog; Highly Expressed in Cancer Protein; Kinetochore Protein Hec1; HsHec1; Kinetochore-associated Protein 2; Retinoblastoma-associated Protein HEC; HEC; HEC1; KNTC2) APC; anti-NDC80 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A10
Specificity
Recognizes human KNTC2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-NDC80 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa545-642 from KNTC2 (AAH35617) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TVNQGLSEAMNELDAVQREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHLEEQIAKVDREYEECMSEDLSENIKEIRDKYEKKATLIKSSEE
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.78kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.78kD).)

Western Blot (WB)

(KNTC2 monoclonal antibody Western Blot analysis of KNTC2 expression in HeLa NE)

Western Blot (WB) (KNTC2 monoclonal antibody Western Blot analysis of KNTC2 expression in HeLa NE)

Testing Data

(Detection limit for recombinant GST tagged KNTC2 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged KNTC2 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-NDC80 antibody
Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity. Required for kinetochore integrity and the organization of stable microtubule binding sites in the outer plate of the kinetochore.
Product Categories/Family for anti-NDC80 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
73,913 Da
NCBI Official Full Name
Homo sapiens NDC80 homolog, kinetochore complex component (S. cerevisiae), mRNA
NCBI Official Synonym Full Names
NDC80, kinetochore complex component
NCBI Official Symbol
NDC80
NCBI Official Synonym Symbols
HEC; HEC1; TID3; KNTC2; HsHec1; hsNDC80
NCBI Protein Information
kinetochore protein NDC80 homolog
Protein Family

NCBI Description

This gene encodes a component of the NDC80 kinetochore complex. The encoded protein consists of an N-terminal microtubule binding domain and a C-terminal coiled-coiled domain that interacts with other components of the complex. This protein functions to organize and stabilize microtubule-kinetochore interactions and is required for proper chromosome segregation. [provided by RefSeq, Oct 2011]

Research Articles on NDC80

Similar Products

Product Notes

The NDC80 (Catalog #AAA6137808) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NDC80 (Kinetochore Protein NDC80 Homolog, Highly Expressed in Cancer Protein, Kinetochore Protein Hec1, HsHec1, Kinetochore-associated Protein 2, Retinoblastoma-associated Protein HEC, HEC, HEC1, KNTC2) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NDC80 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NDC80 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NDC80, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.