<
Western Blot (WB)
(NCOA4 monoclonal antibody, Western Blot analysis of NCOA4 expression in Hela NE.)
Mouse anti-Human NCOA4 Monoclonal Antibody | anti-NCOA4 antibody
NCOA4 (ARA70, ELE1, RFG, Nuclear Receptor Coactivator 4, Androgen Receptor Coactivator 70kD Protein, Androgen Receptor-associated Protein of 70kD, Ret-activating Protein ELE1, D10S170, FLJ32286, H4, PTC, TPC, TST1) (PE)
Gene Names
CCDC6; H4; PTC; TPC; TST1; D10S170
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NCOA4; Monoclonal Antibody; NCOA4 (ARA70; ELE1; RFG; Nuclear Receptor Coactivator 4; Androgen Receptor Coactivator 70kD Protein; Androgen Receptor-associated Protein of 70kD; Ret-activating Protein ELE1; D10S170; FLJ32286; H4; PTC; TPC; TST1) (PE); anti-NCOA4 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1, lambda
Clone Number
1F11
Specificity
Recognizes human NCOA4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-NCOA4 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa505-614 from NCOA4 (NP_005428) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQM
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(NCOA4 monoclonal antibody, Western Blot analysis of NCOA4 expression in Hela NE.)
Western Blot (WB)
(NCOA4 monoclonal antibody, Western Blot analysis of NCOA4 expression in Hela NE.)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to NCOA4 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml])
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to NCOA4 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to NCOA4 on HeLa cell. [antibody concentration 10ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to NCOA4 on HeLa cell. [antibody concentration 10ug/ml])
Testing Data
(Detection limit for recombinant GST tagged NCOA4 is ~0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged NCOA4 is ~0.3ng/ml as a capture antibody.)
Western Blot (WB)
(Western Blot detection against Immunogen (38.21kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (38.21kD).)
Product Categories/Family for anti-NCOA4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
53,291 Da
NCBI Official Full Name
coiled-coil domain-containing protein 6
NCBI Official Synonym Full Names
coiled-coil domain containing 6
NCBI Official Symbol
CCDC6
NCBI Official Synonym Symbols
H4; PTC; TPC; TST1; D10S170
NCBI Protein Information
coiled-coil domain-containing protein 6; papillary thyroid carcinoma-encoded protein
UniProt Protein Name
Coiled-coil domain-containing protein 6
Protein Family
UniProt Gene Name
CCDC6
UniProt Synonym Gene Names
D10S170; TST1
Uniprot Description
CCDC6: Defects in CCDC6 are a cause of thyroid papillary carcinoma (TPC). TPC is a common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue. Papillary carcinomas are malignant neoplasm characterized by the formation of numerous, irregular, finger-like projections of fibrous stroma that is covered with a surface layer of neoplastic epithelial cells. A chromosomal aberration involving CCDC6 is found in thyroid papillary carcinomas. Inversion inv(10)(q11.2;q21) generates the RET/CCDC6 (PTC1) oncogene.
Protein type: Apoptosis; Cytoskeletal; Oncoprotein
Chromosomal Location of Human Ortholog: 10q21.2
Cellular Component: cytoplasm
Molecular Function: protein binding; structural constituent of cytoskeleton
Disease: Thyroid Carcinoma, Papillary
Similar Products
Product Notes
The NCOA4 ccdc6 (Catalog #AAA6159016) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NCOA4 (ARA70, ELE1, RFG, Nuclear Receptor Coactivator 4, Androgen Receptor Coactivator 70kD Protein, Androgen Receptor-associated Protein of 70kD, Ret-activating Protein ELE1, D10S170, FLJ32286, H4, PTC, TPC, TST1) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NCOA4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NCOA4 ccdc6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NCOA4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
