Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human NCAPG Monoclonal Antibody | anti-NCAPG antibody

NCAPG (Condensin Complex Subunit 3, Chromosome-associated Protein G, Condensin Subunit CAP-G, hCAP-G, Melanoma Antigen NY-MEL-3, Non-SMC Condensin I Complex Subunit G, XCAP-G Homolog, CAPG, NYMEL3)

Gene Names
NCAPG; CAPG; CHCG; NY-MEL-3
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
NCAPG; Monoclonal Antibody; NCAPG (Condensin Complex Subunit 3; Chromosome-associated Protein G; Condensin Subunit CAP-G; hCAP-G; Melanoma Antigen NY-MEL-3; Non-SMC Condensin I Complex Subunit G; XCAP-G Homolog; CAPG; NYMEL3); Anti -NCAPG (Condensin Complex Subunit 3; anti-NCAPG antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4B1
Specificity
Recognizes human NCAPG.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
TTFQNEDEKNKEVYMTPLRGVKATQASKSTQLKTNRGQRKVTVSARTNRRCQTAEADSESDHEVPEPESEMKMRLPRRAKTAALEKSKLNLAQFLNEDLS
Applicable Applications for anti-NCAPG antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Partial recombinant corresponding to aa336-435 from human NCAPG (AAH00827) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(HCAP-G monoclonal antibody, Western Blot analysis of HCAP-G expression in HeLa.)

Western Blot (WB) (HCAP-G monoclonal antibody, Western Blot analysis of HCAP-G expression in HeLa.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HCAP-G on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to HCAP-G on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged HCAP-G is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HCAP-G is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-NCAPG antibody
Regulatory subunit of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases.
Product Categories/Family for anti-NCAPG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
114,334 Da
NCBI Official Full Name
NCAPG protein
NCBI Official Synonym Full Names
non-SMC condensin I complex, subunit G
NCBI Official Symbol
NCAPG
NCBI Official Synonym Symbols
CAPG; CHCG; NY-MEL-3
NCBI Protein Information
condensin complex subunit 3; XCAP-G homolog; condensin subunit CAP-G; melanoma antigen NY-MEL-3; chromosome-associated protein G; chromosome condensation protein G
UniProt Protein Name
Condensin complex subunit 3
UniProt Gene Name
NCAPG
UniProt Synonym Gene Names
CAPG; NYMEL3; hCAP-G
UniProt Entry Name
CND3_HUMAN

NCBI Description

This gene encodes a subunit of the condensin complex, which is responsible for the condensation and stabilization of chromosomes during mitosis and meiosis. Phosphorylation of the encoded protein activates the condensin complex. There are pseudogenes for this gene on chromosomes 8 and 15. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]

Uniprot Description

NCAPG: Regulatory subunit of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases. Belongs to the CND3 (condensin subunit 3) family.

Protein type: Cell cycle regulation

Chromosomal Location of Human Ortholog: 4p15.33

Cellular Component: centrosome; membrane; cytoplasm; condensin complex; cytosol; nucleus; actin cytoskeleton

Molecular Function: protein binding

Biological Process: cell division; mitotic chromosome condensation; mitotic cell cycle

Research Articles on NCAPG

Similar Products

Product Notes

The NCAPG ncapg (Catalog #AAA6003123) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NCAPG (Condensin Complex Subunit 3, Chromosome-associated Protein G, Condensin Subunit CAP-G, hCAP-G, Melanoma Antigen NY-MEL-3, Non-SMC Condensin I Complex Subunit G, XCAP-G Homolog, CAPG, NYMEL3) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NCAPG can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Western Blot and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the NCAPG ncapg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TTFQNEDEKN KEVYMTPLRG VKATQASKST QLKTNRGQRK VTVSARTNRR CQTAEADSES DHEVPEPESE MKMRLPRRAK TAALEKSKLN LAQFLNEDLS. It is sometimes possible for the material contained within the vial of "NCAPG, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.