Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged NBR1 is approximately 0.1ng/ml as a capture antibody.)

Mouse NBR1 Monoclonal Antibody | anti-NBR1 antibody

NBR1 (neighbor of BRCA1 Gene 1, 1A1-3B, KIAA0049, M17S2, MIG19) (Biotin)

Gene Names
NBR1; IAI3B; M17S2; MIG19; 1A1-3B
Applications
Western Blot
Purity
Purified
Synonyms
NBR1; Monoclonal Antibody; NBR1 (neighbor of BRCA1 Gene 1; 1A1-3B; KIAA0049; M17S2; MIG19) (Biotin); neighbor of BRCA1 Gene 1; MIG19; anti-NBR1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6B11
Specificity
Recognizes NBR1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-NBR1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NBR1 (NP_005890, 2aa-96aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPV
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged NBR1 is approximately 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NBR1 is approximately 0.1ng/ml as a capture antibody.)
Related Product Information for anti-NBR1 antibody
The protein encoded by this gene was originally identified as an ovarian tumor antigen monitored in ovarian cancer. The encoded protein contains a B-box/coiled coil motif, which is present in many genes with transformation potential, but the function of this protein is unknown. This gene is located on a region of chromosome 17q21.1 that is in close proximity to tumor suppressor gene BRCA1. Three alternatively spliced variants encoding the same protein have been identified for this gene. [provided by RefSeq]
Product Categories/Family for anti-NBR1 antibody
References
1. Brain region- and age-dependent dysregulation of p62 and NBR1 in a mouse model of Huntington's disease.Rue L, Lopez-Soop G, Gelpi E, Martinez-Vicente M, Alberch J, Perez-Navarro E.Neurobiol Dis. 2013 Jan 4. pii: S0969-9961(12)00400-7. doi: 10.1016/j.nbd.2012.12.008. 2. NBR1 acts as an autophagy receptor for peroxisomes.Deosaran E, Larsen KB, Hua R, Sargent G, Wang Y, Kim S, Lamark T, Jauregui M, Law K, Lippincott-Schwartz J, Brech A, Johansen T, Kim PKJ Cell Sci. 2013 Feb 15;126(Pt 4):939-52. doi: 10.1242/jcs.114819. Epub 2012 Dec 13. 3. Molecular determinants of selective clearance of protein inclusions by autophagy.Wong E, Bejarano E, Rakshit M, Lee K, Hanson HH, Zaarur N, Phillips GR, Sherman MY, Cuervo AM.Nat Commun. 2012 Dec 4;3:1240. doi: 10.1038/ncomms2244. 4.Nbr1 is a novel inhibitor of ligand-mediated RTK degradation.Mardakheh FK, Auciello G, Dafforn TR, Rappoport JZ, Heath JK.Mol Cell Biol. 2010 Oct 11. 5.Spred2 interaction with the late endosomal protein NBR1 down-regulates fibroblast growth factor receptor signaling. Mardakheh FK, Yekezare M, Machesky LM, Heath JK.J Cell Biol. 2009 Oct 12.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
103,834 Da
NCBI Official Full Name
next to BRCA1 gene 1 protein isoform a
NCBI Official Synonym Full Names
neighbor of BRCA1 gene 1
NCBI Official Symbol
NBR1
NCBI Official Synonym Symbols
IAI3B; M17S2; MIG19; 1A1-3B
NCBI Protein Information
next to BRCA1 gene 1 protein; B-box protein; cell migration-inducing gene 19 protein; membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigen CA125); migration-inducing protein 19
UniProt Protein Name
Next to BRCA1 gene 1 protein
UniProt Gene Name
NBR1
UniProt Synonym Gene Names
1A13B; KIAA0049; M17S2
UniProt Entry Name
NBR1_HUMAN

Similar Products

Product Notes

The NBR1 nbr1 (Catalog #AAA6172498) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NBR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NBR1 nbr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NBR1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.