Mouse NAT8B Monoclonal Antibody | anti-NAT8B antibody

NAT8B (N-Acetyltransferase 8B (GCN5-Related, Putative, Gene/Pseudogene), CML2, Hcml2, MGC97061, NAT8BP) (MaxLight 490)

Cat. Num. AAA6207516

• Applications: Western Blot
• Purity: Purified
• Synonyms: NAT8B; Monoclonal Antibody; NAT8B (N-Acetyltransferase 8B (GCN5-Related; Putative; Gene/Pseudogene); CML2; Hcml2; MGC97061; NAT8BP) (MaxLight 490); N-Acetyltransferase 8B (GCN5-Related; NAT8BP; anti-NAT8B antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3B6
• Specificity: Recognizes NAT8B.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
• Sequence Length: 227

• Applicable Applications for anti-NAT8B antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: NAT8B (NP_057431.1, 83aa-179aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TRYVDIALRTDMSDITKSYLSECGSCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKALVRTVLQFARDQGYSEVVLDTSN
• Conjugate: MaxLight490
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-NAT8B antibody

The protein encoded by this gene is highly similar to the N-acetyltransferase 8 (NAT8) gene product, which is a kidney and liver protein with homology to bacterial acetyltransferases involved in drug resistance. This gene is localized on chromosome 2 in the vicinity of the NAT8 gene and may represent a pseudogene of NAT8. This gene contains two polymorphic nonsense mutations that disrupt the active site of the protein. The full-length product of this gene contains a complete acetyltransferase domain and is identical in length to NAT8. [provided by RefSeq]

Product Categories/Family for anti-NAT8B antibody

Antibodies; Cancer Markers

NCBI and Uniprot Product Information

• NCBI GI #: 7705328
• NCBI Accession #: NP_057431.1
• NCBI GenBank Nucleotide #: NP_057431.1
• NCBI Official Full Name: putative N-acetyltransferase Camello 2
• Protein Family: Putative N-acetyltransferase