Mouse anti-Human NAT5 Monoclonal Antibody | anti-NAA20 antibody

NAT5 (N-alpha-acetyltransferase 20, NatB Catalytic Subunit, N-terminal Acetyltransferase B Complex Catalytic Subunit NAA20, N-terminal Acetyltransferase B Complex Catalytic Subunit NAT5, NatB Complex Subunit NAT5, N-acetyltransferase 5, NAA20)

Cat. Num. AAA6008663

• Gene Names: NAA20; NAT3; NAT5; dJ1002M8.1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: NAT5; Monoclonal Antibody; NAT5 (N-alpha-acetyltransferase 20; NatB Catalytic Subunit; N-terminal Acetyltransferase B Complex Catalytic Subunit NAA20; N-terminal Acetyltransferase B Complex Catalytic Subunit NAT5; NatB Complex Subunit NAT5; N-acetyltransferase 5; NAA20); Anti -NAT5 (N-alpha-acetyltransferase 20; anti-NAA20 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2C6
• Specificity: Recognizes human NAT5.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSIIPLPHPVRPEDIE

• Applicable Applications for anti-NAA20 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Full length recombinant corresponding to aa1-179 from human NAT5 (AAH05181) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (45.69kD).)

Western Blot (WB)

(NAT5 monoclonal antibody, Western Blot analysis of NAT5 expression in HL-60.)

Testing Data

(Detection limit for recombinant GST tagged NAT5 is 0.3ng/ml as a capture antibody.)

Related Product Information for anti-NAA20 antibody

Catalytic subunit of the NatB complex which catalyzes acetylation of the N-terminal methionine residues of peptides beginning with Met-Asp, Met-Glu, Met-Asn and Met-Gln. Proteins with cell cycle functions are overrepresented in the pool of NatB substrates. Required for maintaining the structure and function of actomyosin fibers and for proper cellular migration.

Product Categories/Family for anti-NAA20 antibody

Antibodies; Abs to Enzymes; Acetyltransferase

NCBI and Uniprot Product Information

• NCBI GI #: 31563514
• NCBI GeneID: 51126
• NCBI Accession #: NP_852669.1
• NCBI GenBank Nucleotide #: NM_181528.3
• UniProt Accession #: P61599; Q5TFT7; Q9D7H8; Q9H0Y4; Q9NQH6; Q9Y6D2; A6NHA3; B2R4G4
• Molecular Weight: 20,368 Da
• NCBI Official Full Name: N-alpha-acetyltransferase 20 isoform c
• NCBI Official Synonym Full Names: N(alpha)-acetyltransferase 20, NatB catalytic subunit
• NCBI Official Symbol: NAA20
• NCBI Official Synonym Symbols: NAT3; NAT5; dJ1002M8.1
• NCBI Protein Information: N-alpha-acetyltransferase 20; natB catalytic subunit; natB complex subunit NAT5; N-acetyltransferase 3 homolog; methionine N-acetyltransferase; N-acetyltransferase 5 (GCN5-related, putative); N-terminal acetyltransferase complex ARD1 subunit; N-acetyltransferase 5 (ARD1 homolog, S. cerevisiae); N-alpha-acetyltransferase 20, NatB catalytic subunit; N-terminal acetyltransferase B complex catalytic subunit NAT5; N-terminal acetyltransferase B complex catalytic subunit NAA20; N-acetyltransferase 5, ARD1 subunit (arrest-defective 1, S. cerevisiae, homolog)
• UniProt Protein Name: N-alpha-acetyltransferase 20
• Protein Family: N-alpha-acetyltransferase
• UniProt Gene Name: NAA20
• UniProt Synonym Gene Names: NAT5; NatB complex subunit NAT5
• UniProt Entry Name: NAA20_HUMAN

NCBI Description

NAT5 is a component of N-acetyltransferase complex B (NatB). Human NatB performs cotranslational N(alpha)-terminal acetylation of methionine residues when they are followed by asparagine (Starheim et al., 2008 [PubMed 18570629]).[supplied by OMIM, Apr 2009]

Uniprot Description

NAA20: Catalytic subunit of the NatB complex which catalyzes acetylation of the N-terminal methionine residues of peptides beginning with Met-Asp, Met-Glu, Met-Asn and Met-Gln. Proteins with cell cycle functions are overrepresented in the pool of NatB substrates. Required for maintaining the structure and function of actomyosin fibers and for proper cellular migration. Belongs to the acetyltransferase family. ARD1 subfamily.

Protein type: Acetyltransferase; EC 2.3.1.88; Lipid Metabolism - glycerophospholipid; Secondary Metabolites Metabolism - limonene and pinene degradation; Amino Acid Metabolism - phenylalanine; Amino Acid Metabolism - tyrosine

Chromosomal Location of Human Ortholog: 20p11.23

Cellular Component: cytoplasm; intracellular; nucleus

Molecular Function: peptide alpha-N-acetyltransferase activity

Biological Process: N-terminal peptidyl-methionine acetylation