Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (45.69kD).)

Mouse anti-Human NAT5 Monoclonal Antibody | anti-NAT5 antibody

NAT5 (N-alpha-acetyltransferase 20, NatB Catalytic Subunit, N-terminal Acetyltransferase B Complex Catalytic Subunit NAA20, N-terminal Acetyltransferase B Complex Catalytic Subunit NAT5, NatB Complex Subunit NAT5, N-acetyltransferase 5, NAA20) (AP)

Gene Names
NAA20; NAT3; NAT5; NAT3P; NAT5P; dJ1002M8.1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NAT5; Monoclonal Antibody; NAT5 (N-alpha-acetyltransferase 20; NatB Catalytic Subunit; N-terminal Acetyltransferase B Complex Catalytic Subunit NAA20; N-terminal Acetyltransferase B Complex Catalytic Subunit NAT5; NatB Complex Subunit NAT5; N-acetyltransferase 5; NAA20) (AP); anti-NAT5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2C6
Specificity
Recognizes human NAT5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
1035
Applicable Applications for anti-NAT5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-179 from human NAT5 (AAH05181) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSIIPLPHPVRPEDIE
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (45.69kD).)

Western Blot (WB) (Western Blot detection against Immunogen (45.69kD).)

Western Blot (WB)

(NAT5 monoclonal antibody, Western Blot analysis of NAT5 expression in HL-60.)

Western Blot (WB) (NAT5 monoclonal antibody, Western Blot analysis of NAT5 expression in HL-60.)

Testing Data

(Detection limit for recombinant GST tagged NAT5 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NAT5 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-NAT5 antibody
Catalytic subunit of the NatB complex which catalyzes acetylation of the N-terminal methionine residues of peptides beginning with Met-Asp, Met-Glu, Met-Asn and Met-Gln. Proteins with cell cycle functions are overrepresented in the pool of NatB substrates. Required for maintaining the structure and function of actomyosin fibers and for proper cellular migration.
Product Categories/Family for anti-NAT5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens N-acetyltransferase 5 (GCN5-related, putative), mRNA
NCBI Official Synonym Full Names
N-alpha-acetyltransferase 20, NatB catalytic subunit
NCBI Official Symbol
NAA20
NCBI Official Synonym Symbols
NAT3; NAT5; NAT3P; NAT5P; dJ1002M8.1
NCBI Protein Information
N-alpha-acetyltransferase 20

NCBI Description

NAT5 is a component of N-acetyltransferase complex B (NatB). Human NatB performs cotranslational N(alpha)-terminal acetylation of methionine residues when they are followed by asparagine (Starheim et al., 2008 [PubMed 18570629]).[supplied by OMIM, Apr 2009]

Research Articles on NAT5

Similar Products

Product Notes

The NAT5 (Catalog #AAA6132489) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NAT5 (N-alpha-acetyltransferase 20, NatB Catalytic Subunit, N-terminal Acetyltransferase B Complex Catalytic Subunit NAA20, N-terminal Acetyltransferase B Complex Catalytic Subunit NAT5, NatB Complex Subunit NAT5, N-acetyltransferase 5, NAA20) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NAT5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NAT5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NAT5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.