Mouse anti-Human CRTAP Monoclonal Antibody | anti-CRTAP antibody

CRTAP (CASP, Cartilage-associated Protein) (Biotin)

Cat. Num. AAA6141364

• Gene Names: CRTAP; OI7; CASP; P3H5; LEPREL3
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CRTAP; Monoclonal Antibody; CRTAP (CASP; Cartilage-associated Protein) (Biotin); anti-CRTAP antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4D9
• Specificity: Recognizes human CRTAP.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-CRTAP antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa307-401 from CRTAP (NP_006362) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KLNDLKNAAPCAVSYLLFDQNDKVMQQNLVYYQYHRDTWGLSDEHFQPRPEAVQFFNVTTLQKELYDFAKENIMDDDEGEVVEYVDDLLELEETS
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.56kD).)

Western Blot (WB)

(CRTAP monoclonal antibody Western Blot analysis of CRTAP expression in HeLa.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CRTAP on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged CRTAP is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-CRTAP antibody

Antibodies; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 5453601
• NCBI GeneID: 10491
• NCBI Accession #: NP_006362
• NCBI GenBank Nucleotide #: NM_006371
• UniProt Accession #: O75718; B2RBL6
• Molecular Weight: 46.4 kDa (398aa)
• NCBI Official Full Name: cartilage-associated protein
• NCBI Official Synonym Full Names: cartilage associated protein
• NCBI Official Symbol: CRTAP
• NCBI Official Synonym Symbols: OI7; CASP; P3H5; LEPREL3
• NCBI Protein Information: cartilage-associated protein
• UniProt Protein Name: Cartilage-associated protein
• Protein Family: Cartilage-associated protein
• UniProt Gene Name: CRTAP
• UniProt Synonym Gene Names: CASP
• UniProt Entry Name: CRTAP_HUMAN

NCBI Description

The protein encoded by this gene is similar to the chicken and mouse CRTAP genes. The encoded protein is a scaffolding protein that may influence the activity of at least one member of the cytohesin/ARNO family in response to specific cellular stimuli. Defects in this gene are associated with osteogenesis imperfecta, a connective tissue disorder characterized by bone fragility and low bone mass. [provided by RefSeq, Jul 2008]

Uniprot Description

CRTAP: Necessary for efficient 3-hydroxylation of fibrillar collagen prolyl residues. Defects in CRTAP are the cause of osteogenesis imperfecta type 7 (OI7). A connective tissue disorder characterized by short stature, short humeri and femora, coxa vara, white sclera, and the absence of dentinogenesis imperfecta. Multiple fractures are present at birth, and patients manifest moderate-severe bone fragility. Death may occurr in the perinatal period due to secondary respiratory insufficiency. Belongs to the leprecan family.

Protein type: Extracellular matrix; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 3p22.3

Cellular Component: proteinaceous extracellular matrix; extracellular space; endoplasmic reticulum lumen; endoplasmic reticulum

Molecular Function: protein complex binding

Biological Process: extracellular matrix organization and biogenesis; protein stabilization; spermatogenesis; peptidyl-proline hydroxylation to 3-hydroxy-L-proline

Disease: Osteogenesis Imperfecta, Type Vii