Mouse anti-Human MYPN Monoclonal Antibody | anti-MYPN antibody

MYPN (Myopalladin, 145kD Sarcomeric Protein, MYOP) (PE)

Cat. Num. AAA6158983

• Gene Names: MYPN; MYOP; RCM4; CMH22; NEM11; CMD1DD
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MYPN; Monoclonal Antibody; MYPN (Myopalladin; 145kD Sarcomeric Protein; MYOP) (PE); anti-MYPN antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4C8
• Specificity: Recognizes human MYPN.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-MYPN antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa61-171 from human MYPN (NP_115967) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PDLSAFLSQEELDESVNLARLAINYDPLEKADETQARKRLSPDQMKHSPNLSFEPNFCQDNPRSPTSSKESPQEAKRPQYCSETQSKKVFLNKAADFIEELSSLFKSHSS
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(MYPN monoclonal antibody, Western Blot analysis of MYPN expression in Hela NE.)

Testing Data

(Detection limit for recombinant GST tagged MYPN is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-MYPN antibody

MYPN is a component of the sarcomere that tethers nebulin (MIM 161650) in skeletal muscle and nebulette (MIM 605491) in cardiac muscle to alpha-actinin (see ACTN2; MIM 102573) at the Z lines (Bang et al., 2001 [PubMed 11309420]). [supplied by OMIM]

Product Categories/Family for anti-MYPN antibody

Antibodies; Cardiac Markers

NCBI and Uniprot Product Information

• NCBI GI #: 153792294
• NCBI GeneID: 84665
• NCBI Accession #: NP_115967
• NCBI GenBank Nucleotide #: NM_032578
• UniProt Accession #: Q86TC9
• Molecular Weight: 145kDa
• NCBI Official Full Name: myopalladin isoform a
• NCBI Official Synonym Full Names: myopalladin
• NCBI Official Symbol: MYPN
• NCBI Official Synonym Symbols: MYOP; RCM4; CMH22; NEM11; CMD1DD
• NCBI Protein Information: myopalladin
• UniProt Protein Name: Myopalladin
• Protein Family: Myopalladin
• UniProt Gene Name: MYPN
• UniProt Synonym Gene Names: MYOP

NCBI Description

Striated muscle in vertebrates comprises large proteins which must be organized properly to contract efficiently. Z-lines in striated muscle are a sign of this organization, representing the ends of actin thin filaments, titin, nebulin or nebulette and accessory proteins required for structure and function. This gene encodes a protein which interacts with nebulin in skeletal muscle or nebulette in cardiac muscle and alpha-actinin. In addition, this gene product can interact with a protein with the I-band indicating it has a regulatory as well as structural function. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2011]

Uniprot Description

Component of the sarcomere that tethers together nebulin (skeletal muscle) and nebulette (cardiac muscle) to alpha-actinin, at the Z lines.